SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050074 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050074
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000353
Family ATI-like 0.045
Further Details:      
 
Domain Number 2 Region: 751-815
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000131
Family ATI-like 0.029
Further Details:      
 
Domain Number 3 Region: 652-713
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000157
Family ATI-like 0.053
Further Details:      
 
Domain Number 4 Region: 1127-1183
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000288
Family ATI-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050074   Gene: ENSBTAG00000037783   Transcript: ENSBTAT00000053054
Sequence length 1197
Comment pep:known_by_projection chromosome:UMD3.1:5:40638741:40667231:-1 gene:ENSBTAG00000037783 transcript:ENSBTAT00000053054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSLFKIVAILCCLLLDLALRFHVHKPLKNKKCEASTWGKGAYKAFNGRVFSFESSCTYTF
CRHCVESGGDFNIEIKRNNDSEIEKITVIIDNNDVSIFGDILLVNGESVQIPYNNKLIHI
KKYGEHNVLNSRRGILSLMWDKNNKLSLTLHKQYPTCGLCGNFNSTPGDDINEHIADSKI
PDDCSKAVSKSYEVCEDGVQILQSSSFCSKGACSYCNKIIGTYFEKCGKVSTLSSDYKMI
CIDEYCQSRDRTSTCDTYSELSRLCASDGPGTFESWRDDPDVVCEKPICPEKHIYKECGP
SNPATCSNVAPFQDTECVSGCTCPEGYLLDDIGEKGRCVLKSDCPCESNGKVYQSGEVRE
GSCGSLCTCQEAKWSCTKTLCPGRCKIEGSLITTFDGVKYNHPGNCHFLAIHDKDWSISV
ELRPCPSGQSGTCLNSVTLLLNSSVQVDKYVFNRDGTVTNDKFGNLGYYYSDKIQIFNAS
SSYLQAETYFHGKMQIQIFPVMQLYVSMPPNQFTDTVGLCGSHNNRAEDDFMSSQNILEK
TSQAFASSWESPNHCHHNFKNNWPQCPFNSQSANKRFAERHCGILLDLSGPFASCHSIVD
PKPYHEECKKYTCTCENSQDCLCTILGNYVKACAEKETSMVGWRAGLCATDQSCPSGLVF
KYNVKTCNSSCRSLSERDKSCDMEGISVDGCTCPDGMYKNNEGNCVSKSQCDCYINDEVM
QPGKLIHIDDNKCVCRDGILLCQTPIDLTLQNCSGGAEYVDCRNPKAQRRVDSTCSTRNI
PSFDENLPCKRGCYCPEGMVRNSKGSCVFPDDCPCSFGGREYDQGSVTSVGCNKCTCIKG
SWNCTQNECQTTCHIYGEGHVRTFDGKSYSFDGLCQYSFIEDYCGRENGTFRILTESVPC
CEDGLTCSRKIIVAFQDQNIVLHDGKVTAVKTTESKECELNGNSYSVHTVGLYLILKFLN
GITIIWDKNTRISVILDPRWNGQVCGLCGNNNGDLKDDFTTRYSSVAAGTLEFGNSWKTS
QECSDTVAQTFPCDSNPYCKAWAVRKCEIIRDSTFRECHNKVDPNEYYDACIEEACACDM
EGKYLGFCTAVAMYAEACSAVGVCVTWRKPDLCPVYCDYYNAPGEFSWHYEPCGTVTAKT
CKDRNATYNIVSLEWRPGCYAKCPDSAPYLDENTMKCVSLAECSCFYNDIVPAGGVI
Download sequence
Identical sequences F1MGF6
ENSBTAP00000050074 ENSBTAP00000050074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]