SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050170 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050170
Domain Number 1 Region: 2-430
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-129
Family ALDH-like 0.000000000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050170   Gene: ENSBTAG00000039161   Transcript: ENSBTAT00000056266
Sequence length 485
Comment pep:known chromosome:UMD3.1:19:34522835:34538828:-1 gene:ENSBTAG00000039161 transcript:ENSBTAT00000056266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRVRAAFGSGRSRPLTFRRRQLEALRVMVQEREKDILAAIGADLSKSEFNAYSQE
VITVLGEIDLMLEKLPEWAAAKPAQRNLLTMLDEAYIQPEPLGVVLIIGAWNYPFALTIQ
PLIGAIAAGNAVIIKPSEVSENTAKLLAKLLPQYLDQDLYAVVTGGVEETTELLKQRFDH
ILYTGNTTVGKIVMQAAAKHLTPVTLELGGKSPCYVDRDCDLDVACRRIAWGKFMNCGQT
CIAPDYVLCEPSLQDLIVQKVQEAVKGFYGENVKESPDYERIVNLRHFKRIQSLLEGQKI
AFGGEMDEATRYIAPTILTDVDPGTKVMQEEIFGPILPIVPVKNADEAIQFINEREKPLA
FYVFSHNSKLIKRMIDGTSSGGVTGNDVIMHFTLSSLPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKTLKREGMNQLRYPPNSQSKVDWAKFFMLKRFNKERLCLLLLTLLGVLAAVLI
KAGYY
Download sequence
Identical sequences A6QQT4
ENSBTAP00000050170 9913.ENSBTAP00000050170 NP_001095454.1.59421 NP_001095454.1.76553 XP_019836598.1.53367 ENSBTAP00000050170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]