SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050251 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050251
Domain Number 1 Region: 31-327
Classification Level Classification E-value
Superfamily L domain-like 4.99e-57
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 392-641
Classification Level Classification E-value
Superfamily L domain-like 1.09e-46
Family Ngr ectodomain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050251   Gene: ENSBTAG00000040106   Transcript: ENSBTAT00000055322
Sequence length 724
Comment pep:known_by_projection chromosome:UMD3.1:5:112904448:112911243:-1 gene:ENSBTAG00000040106 transcript:ENSBTAT00000055322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSARPQSLSLVLLLPLLLPLGPNRCAVAQRCPQACVCDNPRRHVACRHQNLTEVPTAIPE
LTQRLDLQGNMLKEIPPAAFRDLPHLTHLDLRRCQVELVAEGAFRGLGRLLLLNLASNRL
RALPQEALDGLGSLQRLELAGNLLEELRPGTFGALGAVTTLNLAHNALVYLPAMAFQGLV
RARWLQLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGAALSQARGLARLELGHNPF
TYTGEEDGLALPGLRELRLDHGALQALDARAFARCPRLHTLDLRGNQLDALPPLQGPGQL
RRLRLQGNPLWCGCRARPLLEWLARARVRSDGACWGPRRLRGEALDALRPSDLRCPRPGA
EEEEEAEELKAARPRAPGDAPGEEAGAAGPCPRTCVCVPESRHSSCEGRGLQAVPRGFPN
DTQLLDLRRNRFPVVPQAAFPGLGRLVSLHLQHCGLTELEAGALAGLDSLIYLYLADNRL
SGLSAAALEGAPRLGYLYLERNRFVRMPGAALLALPSLFSLHLQDNALDHLAQLHLDRNQ
LGEVPTEALEGLPALLELQLSGNPLGALRDGAFRPVGRSLQHLFLNSSGLEQISPGAFSG
LGPRLRSLHLQKNQLQTLPALPGLGELELVDLSGNPFHCDCQLLPLHRWLAGLNLRVGAT
CATPPSARGQRVKAAAAVFEACPGQAARKAKRTPAPRPGAWGTPTKGRRQRANKEYKGLE
GHGL
Download sequence
Identical sequences F1MCU5
ENSBTAP00000050251 ENSBTAP00000050251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]