SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050557 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050557
Domain Number 1 Region: 414-528,648-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.82e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 23-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-55
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 3 Region: 544-647
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000283
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050557   Gene: ENSBTAG00000004775   Transcript: ENSBTAT00000056038
Sequence length 883
Comment pep:known_by_projection chromosome:UMD3.1:17:42761044:42947091:-1 gene:ENSBTAG00000004775 transcript:ENSBTAT00000056038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences A0A287AEG6 F1MBY1 M3Y321
ENSMPUP00000005722 ENSBTAP00000050557 NP_001172017.2.31192 XP_002716955.1.1745 XP_003482437.2.46622 XP_003794734.1.62490 XP_004017337.1.66739 XP_004394294.1.74151 XP_004421014.1.5094 XP_004772104.1.14098 XP_006732980.1.47382 XP_008512656.1.77740 XP_008512657.1.77740 XP_008683761.1.72690 XP_010834375.1.44457 XP_011223344.1.58354 XP_012002232.1.54773 XP_014699599.1.49734 XP_017916966.1.57651 XP_019482017.1.44202 XP_019588713.1.88060 XP_019833665.1.53367 XP_020009251.1.5219 XP_021554703.1.83697 ENSMPUP00000005722 ENSBTAP00000050557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]