SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050767 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050767
Domain Number 1 Region: 29-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-24
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050767   Gene: ENSBTAG00000038684   Transcript: ENSBTAT00000054001
Sequence length 137
Comment pep:known chromosome:UMD3.1:26:42824587:42832080:1 gene:ENSBTAG00000038684 transcript:ENSBTAT00000054001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPSVIPWALLLSTATTVSTESDEDARKCGGVRRNFSGRISSYSSWEPKCTWTILLERG
YRIVLTIPFLSLNCNEEYVEITDGLPDSTTFGKFCSGGHLVFRSSSNVMTVKYYRSSNQP
VSSFDIFYYGRPSGRKV
Download sequence
Identical sequences E1BLI4
ENSBTAP00000050767 ENSBTAP00000050767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]