SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050785 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050785
Domain Number 1 Region: 7-242
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.86e-84
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050785   Gene: ENSBTAG00000004958   Transcript: ENSBTAT00000055262
Sequence length 247
Comment pep:known_by_projection chromosome:UMD3.1:4:119522032:119565916:-1 gene:ENSBTAG00000004958 transcript:ENSBTAT00000055262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPANRQRELSLKADDHSRIRLKSENSHSSSDYINASPIMDHDPRKPAYIATQGPLPSTVA
DFWQMVWESGCVVVVMLTPLAENGVRQCYRYWPDEGSSLYHIYEVHLVSEHIWCEDFLVR
SFYLKNLQTSETRTVTQFHFLSWYDQGVPSSTRSLLDFRRKVNKCFRGRSCPIIVHCSDG
AGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNA
ILKAFPQ
Download sequence
Identical sequences F1MDF8
ENSBTAP00000050785 ENSBTAP00000050785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]