SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050839 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050839
Domain Number 1 Region: 45-379
Classification Level Classification E-value
Superfamily L domain-like 6.12e-63
Family Ngr ectodomain-like 0.006
Further Details:      
 
Domain Number 2 Region: 429-513
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-20
Family I set domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050839   Gene: ENSBTAG00000040596   Transcript: ENSBTAT00000054778
Sequence length 603
Comment pep:known_by_projection chromosome:UMD3.1:3:19020285:19022096:1 gene:ENSBTAG00000040596 transcript:ENSBTAT00000054778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILCSRNKEGMAVATAPKQAWPPWPPVFFLLLLPALGSSGNCPAVCDCTSQPQAVLCAHRR
LEAVPGGLPLDTELLDLSGNRLWGLQQGMLSRLGQLRELDLSYNQLSTLEPGAFHGLRSL
LTLRLQGNRLRIMGPGVFAGLSALTLLDLRLNQIVLFLDGAFRELGSLQQLEVGDNHLVF
VAPGAFAGLAKLSTLTLERCNLSTVPGPALARLPALGALKLRELDIGRLPAGALRGLGQL
RELEIHHWPALEALEPGSLGGLNLSSLAITHCNLSSVPFQALHHLSFLRALDLSRNPISA
IPARRLSSLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKL
VTLRLSGNPLTCDCRLLWLLRLRRRLDFGSTPPACAGPQHVQGKSLREFADILPPGHFTC
RPALIRKSGPRWVMAEEGGHAVFSCSGDGDPAPTVSWMRPQGVRLGRAGRVRVLQDGTLE
IRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNSTSPGIPGPFFLDSR
GIAMVLAVGFLPFLTSVTLCFGLIALWSKGKGRVKHHVTFDFVAPRTSGDKNSGGNRVTA
KLF
Download sequence
Identical sequences F1N7L3
ENSBTAP00000050839 ENSBTAP00000050839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]