SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050841 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050841
Domain Number 1 Region: 113-459
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-81
Family Subtilases 0.00000000924
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-42
Family Proprotein convertase P-domain 0.0000927
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000000289
Family Prohormone convertase 1 pro-domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050841   Gene: ENSBTAG00000008687   Transcript: ENSBTAT00000052049
Sequence length 638
Comment pep:known chromosome:UMD3.1:13:37812787:38051895:1 gene:ENSBTAG00000008687 transcript:ENSBTAT00000052049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGCISQGKAAAGLLFCVMVFASAERPVFTNHFLVELHRGGEEEARQVAAEHGFGVRKL
PFAEGLYQFYHNGLAKAKRRRSLQHQQQLERDPRVKRALQQEGFNRKKRGYRDINEIDIN
VNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYGSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIP
TTGKLVLTLTTDACEGKENFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDAKVGFDKWPFMTTHTWGEDARGTWILELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVQRSLKSILGKD
Download sequence
Identical sequences A7MBJ9
XP_005214382.1.76553 9913.ENSBTAP00000011451 ENSBTAP00000011451 ENSBTAP00000050841 ENSBTAP00000011451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]