SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050885 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050885
Domain Number 1 Region: 290-550
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-54
Family YWTD domain 0.00000002
Further Details:      
 
Domain Number 2 Region: 162-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000694
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 3 Region: 80-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 4 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 206-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family EGF-type module 0.0025
Further Details:      
 
Domain Number 6 Region: 114-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 7 Region: 242-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 8 Region: 561-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000129
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050885   Gene: ENSBTAG00000000736   Transcript: ENSBTAT00000053259
Sequence length 807
Comment pep:known_by_projection chromosome:UMD3.1:3:93488723:93580869:1 gene:ENSBTAG00000000736 transcript:ENSBTAT00000053259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPERGALRPLALLLLLLQLQHLAAAAADPLHGGQGSVKECDENQFRCRNERCIPSVWR
CDEDDDCSDNSDEDDCPKKTCADSDFTCNNGHCIRERWKCDGEEDCPDGSDESEATCTKQ
VCPAEKLSCGPTSHKCVPASWRCDGEKDCESGADEAGCATSLGTCRGDEFQCGDGTCVPA
IKRCNQEQDCPDGSDETGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGYQLLDQKTC
GDIDECEDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGRSPSLIFTNRHEVRR
IDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASNPVEQDVLIDE
QLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGKRRCTLFSRNLSEPRAIAVDPLQGFM
YWSDWGFQAKIEKSGLNGVGRQTLVSDGIEWPNGITLDLLNQRLYWVDSKLHQLSSIDFS
GGNRKMLISSPDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISVLAENLNNPHD
IVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRC
YRAPQSTSTTTLASTTARTLADTTRAPGTTNHSPTYQNHSTETPSLATEVPSSVSVPRAP
SISPSTPSPATSNHSQHYGNEDGKMGSTVTAAVIGIIVPMEKSRNTPEKEYAETEPEEQG
AVNIGRTAQIGHVYPAAISSFDHPLWAEPCLGETRELEDPAPALKELFVLPGEPRSQPHQ
LPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences F6PYA5
ENSBTAP00000050885 ENSBTAP00000050885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]