SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050909 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050909
Domain Number 1 Region: 161-269
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 385-493
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 26-135
Classification Level Classification E-value
Superfamily SRCR-like 1.15e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 268-374
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050909   Gene: ENSBTAG00000024318   Transcript: ENSBTAT00000052854
Sequence length 728
Comment pep:known chromosome:UMD3.1:5:102940224:102966384:1 gene:ENSBTAG00000024318 transcript:ENSBTAT00000052854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRHLSLQGLCVLLLGTMVGGQDLELRLKDGTHRCEGRVEVKHQGQWGTVNDYGWGLE
EAAVVCRQLRCGAAVEAPRGAYFGPAAGPIWFYYVLCGGTESALTECQYSSIRDFSEDGF
IHDWDAGAVCSGNQTQVLPQCKYPVSEPAASASPEESAPYCSDSRQLRLVDGGGHCAGRV
EILDQGSWGTICDDGWDLDDARVVCRQLGCGEALYATRSAHFGAGSGPIWLDDLNCTGKE
SHVWRCPSRGWGQHDCRHKQDAGVICSDFLAVRMVRKDQECAGWLEVFYNGTWGSICRSP
MEDITVSMICRQLDCGNSGSLTTSVALREGSRPRWVDRIRCQKTDTSLWQCPSDPWNYNS
CYPKDEAYISCAGGKHKSCPTAAPCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDSW
SLAEAEVVCQQLGCGPALEAVPAATFGPGNGSIWLDEVRCGGRESSLWDCAAEPWGQSDC
KHEEDAGVRCSAPDPGILSLPMIICIILGALLFMVLIILGIQLHRWRAEHQELSDFEAAV
DEAVYQEIDDIIKPGKKDLLDSQGNLSDDSATKLPYYTGDDGEDGDPDSASDPLRQRINT
TGNGYDDVDELPVPVNLFFPGMNENNFSPEDRGGARYSQTKPPGQNINTIGNGYDDVDEL
PVPINPFFPGMNENNFFPDDRGGARYSQTGMSLKSLRETVDSGVEEKESSLVLRQEEPGY
DDVELSTM
Download sequence
Identical sequences F1MR79
ENSBTAP00000050909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]