SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050956 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050956
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000216
Family LEM domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050956   Gene: ENSBTAG00000034632   Transcript: ENSBTAT00000054874
Sequence length 183
Comment pep:known_by_projection chromosome:UMD3.1:16:2975238:3005255:-1 gene:ENSBTAG00000034632 transcript:ENSBTAT00000054874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEVKCLSDDELQNELHKLGFPPGPILPSTRKVYEKKLVQLLVSTPCAPPKKNGPGELNR
AQDNDDSEEFNATIILKRNITPSSEKSKGPKNRCKTSTSKPKAVEIFCSDSKRTEGRRCA
ARTSNIRCKALRNLKEKACCRANRRAGDSGLETFPMGLTLAVFGILVIVIFVYITMESKS
LFG
Download sequence
Identical sequences E1BH65
ENSBTAP00000050956 9913.ENSBTAP00000050956 ENSBTAP00000050956 XP_015322161.1.59421 XP_015330520.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]