SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051107 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051107
Domain Number 1 Region: 299-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 198-289
Classification Level Classification E-value
Superfamily PKD domain 0.0000000157
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051107   Gene: ENSBTAG00000032007   Transcript: ENSBTAT00000053631
Sequence length 488
Comment pep:known chromosome:UMD3.1:9:88115145:88183299:-1 gene:ENSBTAG00000032007 transcript:ENSBTAT00000053631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESAGLGRRRPPPRRALPGLLLLCLWLPGGRAAGSPSAPLSELHAQLSGVEQLLEEFRRQ
LQQERPQEELELELRAGGDPQEGCPGPGGGGYRARPDAIIRTKDSIAAGASFLSAPAAVQ
DWRQCLQACCLEPHCSVAVVELPRRPAPPATALGCYLFNCTWRGRSVCKFALHRGYSSYS
LSRSPEGEHFPKEKEKDEPPLSKAGQDVVLHLPTDGVILDGRESTDDHAIVQYEWTLLQG
DPTVDMKVPQSGTLKLSHLREGAYTFQLTVMDTAGQRSSDNVSVTVLPVAFSTTGCSSVC
SRYHFFCDDGCCIDIMLACDGVEQCPDGSDEAFCQNLSDNRKMVTHRTTARPKTTGPSTD
AGRSASLEKSEKATTPEQPPELSTTEKSNHSTFWGPESRIDLEMPDGGSSGKNRKEENYI
FESKSNRGGGEHPAPEAGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEESD
YLINGMYL
Download sequence
Identical sequences F1MXN4
ENSBTAP00000051107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]