SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051130 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051130
Domain Number 1 Region: 351-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 942-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 835-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 4 Region: 881-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 787-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 6 Region: 526-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 7 Region: 990-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 474-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 287-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 10 Region: 414-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1147-1195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1042-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 13 Region: 1099-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051130   Gene: ENSBTAG00000022635   Transcript: ENSBTAT00000057452
Sequence length 1802
Comment pep:known chromosome:UMD3.1:22:51456200:51470441:1 gene:ENSBTAG00000022635 transcript:ENSBTAT00000057452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWVAAGGRGRDLPGQPGPWQLHLGLLLSVLVTALAQAPAPDVPSCSRGSCYPATGDLLV
GRADRLTASSTCGLRGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFA
PQRRAAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYR
YFSYDCAADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRI
QNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAP
GAPAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDRHSHACKKCECHGHAHSC
HFDMAIYLASGNVSGGVCDGCQHNTAGRQCELCRPFFYRDPTKDLRDPAVCRSCDCDPMG
SQDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSANNPLGCQRCQCDPRG
TVPGGTPCDRNSGACFCKRLVTGQGCNRCLPGHWGLSHDLLGCRPCDCDIGGALDPQCNE
ATGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEEPRGQVLDVVERLVTPGGTPSWTG
PGFVRLQEGQVLEFVVASVPRAMDYDVLLRLEPQVPEQWAEMELTVQRPGPVSARSPCGH
VLPQDDHIPGTLRPGSRHMVFPRPVCLEPGISYKLHLKLVRTGGSAQPEAPYSGASLLID
SLVLLPRVLVLEMFSGGDAASLERRATFERYRCHEEGLMPSKPLPSEACAPLLISLSTLL
YNGALPCQCDPQGSLSSECNPHGGQCRCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPE
GALSGLCDATSGQCPCRAGAFGLRCDRCQRGQWGFPSCRPCVCHGHADECDPNTGTCLGC
RDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQVVCHC
RAGYTGLRCEACAPGHFGDPSRPGGGCQPCECSGNIDPTDPDACDPHSGQCLHCLYHTEG
PRCAHCKPGFHGQAARQSCHRCTCNLLGTDARQCPSTDHCNCDPSSGQCPCLPNVQGLSC
DRCAPNFWNLTSGRGCQPCACHPSRARGPACNEFTGQCHCRAGFGGRTCSECQELHWGDP
GLQCRACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPTCHPCHACFGD
WDRVVQDLAARTRRLEQWTQELQQTGVLGAFESSFRHLQEKLGTVQGIVAARNASAASTA
QLVEATKELRREIGEATEHLTRLEAELTDVQDDNFNANHALSSLERDGLALNLTLRQLDQ
HLDLLKHSNFLGAYDTIRQAHSLSAEAERRANMSALIVPSPVSNSADTRHRTESLMSARR
EDFNRRHIANQRALGELSARTHALSLTGINELVCGSPGDAPCATSPCGGAGCRDEEGQPR
CGGLSCSGAAAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALD
KAHASRGQVEQANQELRQLIQNVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQQLA
GEIAERVRSLADVDTILARTVGDVRRAEQLLNDARRARSRAEGEKQKAETVQAALEEAQR
AQGAAQGAIQGAVVDTQDTEQTLHQVQERMAGAEQALSSAGERAQQLDGLLEALKLKRAG
NSLAASSAEETAGSAQDRAREAEQLLQGPLGDQYQTVRALAERKAQDVLAAQARAEQLRD
EARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNT
CQ
Download sequence
Identical sequences E1BDK6
ENSBTAP00000051130 XP_015315068.1.76553 ENSBTAP00000051130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]