SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051287 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051287
Domain Number 1 Region: 56-291
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.36e-59
Family Alanine racemase-like, N-terminal domain 0.000000422
Further Details:      
 
Domain Number 2 Region: 259-411
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-29
Family Eukaryotic ODC-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051287   Gene: ENSBTAG00000039994   Transcript: ENSBTAT00000056771
Sequence length 424
Comment pep:novel chromosome:UMD3.1:2:122742371:122756595:-1 gene:ENSBTAG00000039994 transcript:ENSBTAT00000056771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSIPIGNSKESKESPGSTWPKDIIALEPGETAWDVVLKKIKELSDSDCRHAFMVADLDVL
ASRHQVFRQALPRVSPFYVVKCNSSPWMLRVLAALGTSFDCSSQGELEQVLDLGVAPSRI
VYANACKPVSHIRFASLHGVKLLVFNSEEELIKVAQHHPGARLVLWWTQDSDSIFPLSSK
FGARLEVCEHLLESARDLGLAVVGTSFHVGSRCQTPRNFMKAIVDCRRVFEMGSSIGHDM
SLLDIRGGFSREEGSDPEFEEVAGVINAALAQDFPEGSGVEVIAEPGRFYATFVCTTAVN
IIAKKAVLEPRGRRKLLYYLNDGHYGTFRIFPRESEPRMPIMVKELSPKLSLFPCTLFGP
TCDAFDKLFLKEVQLPELDVGDWLVFPFMGAYTSVLSSTFSGLSPTSICYAVGPELRSLL
ETTP
Download sequence
Identical sequences F1MXF0
ENSBTAP00000051287 ENSBTAP00000051287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]