SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051333 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051333
Domain Number 1 Region: 304-412
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000975
Further Details:      
 
Domain Number 2 Region: 527-635
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 2-108
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 4 Region: 109-210
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0025
Further Details:      
 
Domain Number 5 Region: 411-518
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 
Domain Number 6 Region: 211-278
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051333   Gene: ENSBTAG00000048175   Transcript: ENSBTAT00000052602
Sequence length 867
Comment pep:novel chromosome:UMD3.1:5:102894599:102923181:1 gene:ENSBTAG00000048175 transcript:ENSBTAT00000052602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELRLKDGSHSCEGRVEVKHQGEWGTVNDLNWSLEEAAVVCRHLGCGSAVDAPKRAKFGP
GNGPIWFHYIHCKGPESAITECSYSTVEDHHPKGHSHDNDAGASCSGFVRLVEGDGPCLG
RVEVHSGEHWTPVSDGNFALPIAQVICAELGCGKAVSVLDHLPFRKSNGRVWAEEFRCKG
EERKLQFCPRVPCPGGTCHHSGAVQVRCRSGYSEVRLMTNGSSQCEGQVEMNISGQWRAL
CASHWTLANANIVCRQLGCGVALSTHRGSHFMEGGNYTQALLHCKNCVSITTDSAASEES
APYCSDSRQLRLVHGGGPCARRVEILDQGSWGTICDDGWDLDDARMVCRQLGSGDALNAT
RSAHFGAGSGPIWLDDVNCTGNESLVWRCPSRGWGRQYCRHKQDAGVICSEFLALRMVSR
DQQCAGWLEVFYNGTGSVCRSPMEDITVSVICSQLGCGNKGTLNTFVDLREGSRPRWVDG
IQCRKTDTSLWQCPSDPWKYTSCSPYQEAYISCAGGRHQSCPTAAPCTDREKLRLKGGDS
ECSGQVEVWHSGSWGTVCNDSWSLAEAEVVCQQLGCGPALEAVRAAVFGPGSGSIWLDEV
RCRGQESSLWDCAGEPWGQDCKHEEDAGVRCSGSAPNPGIFSLPVILCIILRALLFMVFI
ILGIQLHRWRAEHQALSAFEDVVGEGLYQEIDDLIKPGRKDLLDSQGNLFDDSEPKLPYY
TGDDGEDEDPDSAPVTDVQDPSPTSSGSPRASEAPPPTNSVSPRVSESTWTPGFSWSRLK
PPGQNINAIGNGYDDVDELPVPINPFLPGMNENNFSPKDRGDARYSQTGISLKSLRETVS
SGVEEKESSLVLRLEEPGYDDVEPSTM
Download sequence
Identical sequences F1MVL1
ENSBTAP00000051333 ENSBTAP00000051333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]