SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051405 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051405
Domain Number 1 Region: 47-206
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-20
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 2 Region: 395-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 271-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000785
Family Growth factor receptor domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051405   Gene: ENSBTAG00000004207   Transcript: ENSBTAT00000005511
Sequence length 661
Comment pep:known_by_projection chromosome:UMD3.1:13:42244268:42247239:-1 gene:ENSBTAG00000004207 transcript:ENSBTAT00000005511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPPGRQPPTQRDTEATMASSAGLLLLLLLLSIQSRAENTTDWEAVVCAGSACYTAHRHK
LSAEDAQLHCSKKGGNLATVKSEEEAWHIQGALTQLLLLGPPLQERSKFWIGLQREKGTC
SDSSLPLKGFSWLGDGEDSQYNNWYKEVRSTCTHRRCVSLILDLSVPGLASGLSKWVDGP
CGHSGFPGMNIEGFVCKFSFKGMCRPLTLGGPGQVNYTTPFQATSSSLQAVPFASMATVA
CEDGNEGRQHYFLCKEKAPSEFDWDSSGPLCVSPKFGCDFNNGGCQQDCFEGGDGSFRCG
CRPGFRLLDDLVSCASRNPCSSNPCGGEATCFPGSLGTDFTCHCPPGYQLDSTQRDCVDV
DECRDNPCAQDCVNTPGSFRCECWVGFEPGGPEEGACVDVDECAPGHSPCAQSCTNTEGS
FYCSCEEGYELAEEDGTQCLDVDECEVQQGGLCDSLCFNTEGSFRCGCLPGWELDPNGVS
CTGGHTSLGPPTGFPLREDTGNGEGKLQSSATVWDNPEGTSTVVPSNRRLSLPARVFTSL
PPSEMLAPSATPGVWMEPSTHYPTATTGHRESAGEDFTAKQSEQGTDGQQLLLFYILGTV
VAILLLLALALGLLVCRKRRAKKEEKKQQPQSAADSYAWVPERAESRAMENPYSPTPGTD
C
Download sequence
Identical sequences E1BGJ5
ENSBTAP00000051405 ENSBTAP00000051405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]