SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051470 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051470
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-82
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 320-424
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-21
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 474-547
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000128
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051470   Gene: ENSBTAG00000037921   Transcript: ENSBTAT00000052858
Sequence length 548
Comment pep:known_by_projection chromosome:UMD3.1:15:45601855:45623566:1 gene:ENSBTAG00000037921 transcript:ENSBTAT00000052858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHISKKKLILLFGIIFLEQSKSATLSLPKVSTCGQSPVKSQPLNYLNIFSRIVGGRQVAK
GSYPWQVSLKQRQKHVCGGTIISPQWVITAAHCVANRNTVSTFNVTAGEYDLRYVEPGEQ
TLTIETIIIHPHFSTKKPMDYDIALLKMAGAFRFDQFVGPMCLPEPGERFKPGFICTTAG
WGRLSENGISPQVLQEVNLPILTQDECITALLTLEKPISGRTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGTWTMAGVTSWGLGCGRGWKNNLQKDDQGSPGIFTDLTKVLSWIHKHIRI
GNQAKTWKKTKTTCSEQDRVVRALEGDLHFPESPFLYYESKQQCAWTLLVPEEMHVLLSF
SHFDAESCDHNYLSIYSLEDTLIAKFCGERLASSVLVGSNAIRLSFISDNTDNAVGFNLT
YKAVKPNYLPDGNCRQLCTLLFVEKLPLPLYQKEFQEGFKKCLKQAEQLKFFCLIKLSFQ
DLKIEENGDCTSDYVSVHRDVERKKEIARLCGFAVPTPVVSITRVMSISFQSNENANFRG
FQATVSFV
Download sequence
Identical sequences E1BFX9
ENSBTAP00000051470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]