SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051578 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051578
Domain Number 1 Region: 178-386
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.25e-69
Family Eukaryotic proteases 0.00059
Further Details:      
 
Domain Number 2 Region: 86-186
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-16
Family Hepsin, N-terminal domain 0.085
Further Details:      
 
Domain Number 3 Region: 40-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051578   Gene: ENSBTAG00000021518   Transcript: ENSBTAT00000055576
Sequence length 390
Comment pep:known chromosome:UMD3.1:15:29193486:29233495:1 gene:ENSBTAG00000021518 transcript:ENSBTAT00000055576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPCANPAPRWRSKKVGIPIIAAVLILATIIVVAVLIKVILDSYFFFCGQPLLFIPREQ
VCDGHQDCASGEDEKYCVKKLPDGPPVAVRLSRDRSTLQVLNPATKNWASACFDSFTEAL
AKTACRQMGYDSSKPTFRAVDAGPAQDLDIVKVTENLQELQVQNSSGPCLSGSLVSLQCL
ACGQSVKAPRVVGGKEASVDSWPWQVSIQYDKQHICGGSILDPHWILTAAHCFWKHLDVP
NWKVRAGSDRLGSFPSLPVAKIFILEPNATYPREHDIALVKLQLPLTFSGKMSDILQQGS
VQLINRTRCNAEDAYQGEVTKTMMCAGLPEGGVDTCQGDSGGPLMYHSDWWQVVGIVSWG
HGCGGPTTPGVYTKVTAYLNWIYNVRKSDP
Download sequence
Identical sequences A6QPX2
ENSBTAP00000051578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]