SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051685 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051685
Domain Number 1 Region: 115-219
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.54e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051685   Gene: ENSBTAG00000021447   Transcript: ENSBTAT00000052408
Sequence length 555
Comment pep:known_by_projection chromosome:UMD3.1:1:150696150:150728567:1 gene:ENSBTAG00000021447 transcript:ENSBTAT00000052408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVELTGNSIYEYIHPSDHDEMTAVLAAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGL
TCSGYKVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFR
ASLDLKLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYY
RLLSKLGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTDIEYKELQLSLDQVSTSKSQDS
WRTALPTSQETRKLAKPKNTKMKTKLRANPYPAQQYGSFQMDKLECGQLGSWRASPPAHG
PAPPEQQLHSEGGDLLYAPSYGLPFSYHYGPFPLDSHVFSSKKPVLPAKFGQPQGPPCEV
ARFLLSTLPAGGECQWHYASPIVPGSPSPAKSFSEPPVNPARHSLMPNYEGGSCLHEGCG
QDSGRVAVPSRPHCERFPRLRPCPCASWAPGRQTGLAIQRAAKQRSSVEVSPAAPRPREA
PASFPGQPQAEGRRSRSGSAAPTAAEQTXGPGAPEAAGGALRARAPGPAGPAAAPPPGAP
RPHYLGASVIITNGR
Download sequence
Identical sequences F1MKK8
ENSBTAP00000051685 ENSBTAP00000051685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]