SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051763 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051763
Domain Number 1 Region: 339-445
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000782
Further Details:      
 
Domain Number 2 Region: 565-676
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 3 Region: 1-103
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 4 Region: 448-555
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 106-210
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 210-313
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051763   Gene: ENSBTAG00000039847   Transcript: ENSBTAT00000057422
Sequence length 854
Comment pep:novel chromosome:UMD3.1:5:102324719:102353256:1 gene:ENSBTAG00000039847 transcript:ENSBTAT00000057422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRLVDGGSPCAGRVEILDRSSWGTICDDGWDLDDARVVCRQLGCGEALDATVSSSFGSG
SGPIWLDNVRCTGKESHVWRCPSRGWGKHYCDHSEDAGVICSGRFVRLAGGDGPCSGRVE
VHSGEAWIPVSDGNFKLSTAQVICAELGCGKAVSVLGHMPFRESNGRVWAEEFRCEGEEP
KLWSCPRVPCPGGTCHHSGAAQVVCSVYTDIRLMKNGTSSCEGQVEMNISGQWRALCASH
WSLANANVVCHQLSCGVAISTPNRAEGSDQLWKAWFHCSGTESFLWKCPVTALGVPDCSH
GNTASVICSGNQTQVLPQCNDSVSEPAGSAASEESAPNCSDSRQLRLVDGGGPCAGRVEI
LDQGSWGTICDDGWDLDDARVVCRQLGCGEALNATRSAHFGAGSGPIWLDDLNCTGNEFH
VWRCPSRGWGRHDCRHKEDAGVICSVLEFLALRMVSEDQLCAGWLEVFYNGTWGSVCRSP
MDDVTVSIICRQLGCGDSGSLNSSVGLREGSRPRWVDLIQCRKTDTSLWQCPSDPWKYSS
CSPKEEAYISCAGRRPKSCPTAAPCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDSW
SLAEAEVVCQQLGCGRALEALRAAAFGPGNGSIWLDEVRCWGRESSLWDCAAEPWGQSDC
KHEQDAGVRCSGARTTLPLATAGTKTTSNPLPGIFSLPGVLCLFLGALLFLVLVILVTQL
LRWRAERRALSSYEESLAEAVYEELDDFVTPSRGCGEEPPDQRTDVPAENYDDAEEVSVP
GTLPASQGSEEKVPPEKEDGVRSSQKGSSLNFSREVADPGEGEESPWLLQGKDGDPEYDD
VELSTLGTPPVAFP
Download sequence
Identical sequences E9QB09
ENSBTAP00000051763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]