SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051819 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051819
Domain Number 1 Region: 79-134
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-17
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 2 Region: 47-91
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000154
Family Fibronectin type II module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051819   Gene: ENSBTAG00000023434   Transcript: ENSBTAT00000055955
Sequence length 134
Comment pep:known chromosome:UMD3.1:18:51949246:51953706:1 gene:ENSBTAG00000023434 transcript:ENSBTAT00000055955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLGLFLIWAGVSVFLQLDPVNGDQDEGVSTEPTQDGPAELPEDEECVFPFVYRNRKH
FDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCS
LSPNYDKDRAWKYC
Download sequence
Identical sequences P02784
NP_001001145.1.59421 NP_001001145.1.76553 ENSBTAP00000051819 ENSBTAP00000051819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]