SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051840 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051840
Domain Number 1 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000967
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 2 Region: 131-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 167-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000051840
Domain Number - Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000717
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 209-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000859
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0857
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051840   Gene: ENSBTAG00000037899   Transcript: ENSBTAT00000056239
Sequence length 308
Comment pep:known chromosome:UMD3.1:21:67274800:67283089:1 gene:ENSBTAG00000037899 transcript:ENSBTAT00000056239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATAALLPALLLLLAFGRSAHGAECFPACHPENGFCDDDSVCRCQPGWQGPLCDQCVTF
PGCVNGLCVEPWQCICKDGWDGHLCDLDIRACTSTPCANNGTCLNLDDGQYECSCAPGFS
GKDCQEMDGPCVVNGSPCQHGGSCVDDEGRAPHAVCLCPPGFSGNFCEIVTNSCIPNPCE
NQGICTDIGGDFRCRCPAGFMDKTCSRPVNTCTSEPCLNGGTCLQHSQAICFTILGVLTS
LVVLGTMGIVFLNKCEAWVSNLRYNHMLRKKKNLLLHYNSGEELAVNIVFPEKIDMTTFT
KEAGEEEI
Download sequence
Identical sequences O46370
ENSBTAP00000051840 NP_776462.1.59421 NP_776462.1.76553 ENSBTAP00000051840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]