SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051873 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000051873
Domain Number - Region: 77-158
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0356
Family Heme oxygenase HemO (PigA) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051873   Gene: ENSBTAG00000038074   Transcript: ENSBTAT00000054755
Sequence length 275
Comment pep:known chromosome:UMD3.1:25:36995861:37002546:1 gene:ENSBTAG00000038074 transcript:ENSBTAT00000054755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSFLRRVAAEESRHPTPVGRLLLPALLGLRLVLLAAGGTGVFGGGEEQSEFVCHTQQA
GCKAVCYDAFHPLSPLRFWAFQVTLVAVPSALYMGFILYHVIWHWEASEKVKTEEETLSQ
GEKGGEASRAGSSRLLWAYVAQLGVRLALEGAALGGQYHLYGFRMPSSFVCRLEPCLGST
NCYLSRPSEKSIFLKTMFGVTGLCLLFTLLELVLLGLGRWWRIWRHKSPSSNYSPTSQSA
KRCKAPTDNFPVVEIRERPGEAGERGSEVPLSARP
Download sequence
Identical sequences A3KN25
NP_001076962.1.59421 NP_001076962.1.76553 XP_019842655.1.53367 ENSBTAP00000051873 9913.ENSBTAP00000051873 ENSBTAP00000051873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]