SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051925 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051925
Domain Number 1 Region: 279-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-39
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-17
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000412
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051925   Gene: ENSBTAG00000038169   Transcript: ENSBTAT00000055611
Sequence length 449
Comment pep:novel chromosome:UMD3.1:29:5845679:5851558:1 gene:ENSBTAG00000038169 transcript:ENSBTAT00000055611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLEAFQSELTCSICMNCFLDPITIDCGHSFCRPCLSLCWEEGQSPRNCPECRGIEE
RPHFQTNIVLKSLASLARQARADHDHSSEEQICVTHQEAKGLFCEADQTLLCGPCSERPE
HAAHSHSPIHKAAEESREKFLKRMSSLWKMREEMQLILNQEAKKTQSFKKYVTLRKVMIK
FEYQRRHPLLQEEKKPHLEALKKEAKEICLQLKESVFRMTQYIERLREMYRELTEMCHKP
DTELLQAMGNVLEMTYLAQMQTPQPVNPELTCWPVAGILDTLNNFRVDNVLTQTTIHHLS
LDDASVMSGDDPQGMSRQLDGGESFVAWGAQAFTSGRHYWELDVTHFSNWILGVSKDILT
SDTIIRINYEEAFLLFSEKVNDQYSLFTNSPPLVQFVKRPLGKIGVFLDYDNGALSFYDV
SRGSLIHSFLPSSISSPLKPFLCLRSPRI
Download sequence
Identical sequences F1MKF9
ENSBTAP00000051925 ENSBTAP00000051925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]