SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051948 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051948
Domain Number 1 Region: 370-478
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 2 Region: 600-701
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000968
Further Details:      
 
Domain Number 3 Region: 25-133
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 4 Region: 237-344
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 
Domain Number 5 Region: 477-585
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 6 Region: 134-237
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051948   Gene: ENSBTAG00000039470   Transcript: ENSBTAT00000055884
Sequence length 702
Comment pep:novel chromosome:UMD3.1:5:103170324:103207769:-1 gene:ENSBTAG00000039470 transcript:ENSBTAT00000055884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRHLSLQGLCVLLLGTMVGGQALELRLKDGAHHCEGRVEVKHQGEWGTVNDVKWSLK
DASIVCRQLGCGAAIGFPGGAYFGPGLGPIWLLYTSCDGTESTVSDCRHSNIIDYRNDSY
SHDWDAGVVCSGFVRLAGGDAPCSGRVEVYSGEAWIPVSDGNFTLPTAQVICAELGCGKA
VSVLGHELFRESSARVWAEEFRCEGEEPELWVCPRVPCPGGTCHHSGSAQVVCSAYSEVR
LMTNGSSQCEGQVEVKISGRWRALCASHWSLANANVVCRQLGCGVAISTPGGPHLVEGGD
QILTARFHCSGAESFLWSCPVTALGGPDCSHGNTASVICSGNQTQVLPQCNNSMAEPAGS
AASVESAPYCSDSRQLRVVGGASPCAGRVEIFDQGSWGTICDDGWDLDDAHVVCRQLGCG
EALNATGSAHFGAGSGPIWLDDLNCTGKESHVWRCPSRGWGRHDCRHKQDAGVICSEFLA
LRMVNEDQQCAGWLEVFYNGTWGSVCRSPMEDITVSVICRQLGCGDSGSLNSSVGLREGS
RPRWVDGIRCQKTDTSLWQCPSDPWNYTSCSPKEEAYISCAGRRPCSCSTPEPSKSREKL
VLRDGRGHCAGRVEILDQGSWGTICDDGWDLDDAHVVCRQLGCGQALNATTSAHFGAGSG
PIWLDDLNCTGKESHLWKCPSRGWGQHDCRHKQDAGVICSGL
Download sequence
Identical sequences E1BBT3
ENSBTAP00000051948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]