SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051978 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051978
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.85e-22
Family Ribosomal L11/L12e N-terminal domain 0.0000363
Further Details:      
 
Domain Number 2 Region: 75-145
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000000432
Family Ribosomal protein L11, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051978   Gene: ENSBTAG00000010680   Transcript: ENSBTAT00000014127
Sequence length 163
Comment pep:novel chromosome:UMD3.1:12:51005936:51007152:-1 gene:ENSBTAG00000010680 transcript:ENSBTAT00000014127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGYHLNEVKVVYLWCTGGEVGVVSALLPKIGPLGLFPKEVDGDTTKATGDWKGLRIKM
KMTTQNRQAKAEVIPSASALILKALKEPPRQKQKNIKHSGNITFDEIINIAQQIWHQSLP
RELSGTIKEILATGQSVGCNADSCHPHDVIDDINSGVVECATG
Download sequence
Identical sequences F1MB63
ENSBTAP00000051978 ENSBTAP00000051978 9913.ENSBTAP00000051978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]