SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052015 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052015
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 1.56e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.02e-22
Family Integrin beta tail domain 0.00099
Further Details:      
 
Domain Number 3 Region: 357-468
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-21
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000319
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000052015
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052015   Gene: ENSBTAG00000015910   Transcript: ENSBTAT00000056716
Sequence length 801
Comment pep:known chromosome:UMD3.1:13:20248945:20292114:1 gene:ENSBTAG00000015910 transcript:ENSBTAT00000056716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSVCCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTNEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKNSETIKIKPLGFTEEVEIILQFICECECQGEGIPGSPKCHDG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCM
AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
Download sequence
Identical sequences A0A140T8D2
XP_005214205.1.76553 XP_010809399.1.76553 ENSBTAP00000052015 9913.ENSBTAP00000052015 ENSBTAP00000052015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]