SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052092 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052092
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 4.35e-19
Family PUA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000052092
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052092   Gene: ENSBTAG00000017191   Transcript: ENSBTAT00000022847
Sequence length 181
Comment pep:known chromosome:UMD3.1:13:44229670:44230470:1 gene:ENSBTAG00000017191 transcript:ENSBTAT00000022847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLMEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPRQQVDKGAIKFVLSGANIMCPGLTSPG
ARLFPAAVDTVVAIMAEGKQHALCVGVMKMSADEIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences A6QLG1 L8I785
NP_001093838.1.59421 NP_001093838.1.76553 XP_006078364.1.26621 XP_010834703.1.44457 XP_014335629.1.15283 XP_019828872.1.53367 XP_020757918.1.74333 9913.ENSBTAP00000052092 ENSBTAP00000052092 ENSBTAP00000052092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]