SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052231 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052231
Domain Number 1 Region: 127-183
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-18
Family Fibronectin type II module 0.001
Further Details:      
 
Domain Number 2 Region: 96-138
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000137
Family Fibronectin type II module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052231   Gene: ENSBTAG00000018882   Transcript: ENSBTAT00000054953
Sequence length 183
Comment pep:known chromosome:UMD3.1:18:51926743:51931019:1 gene:ENSBTAG00000018882 transcript:ENSBTAT00000054953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLVGLFLIWAGASVFQQLHPVNGGDIPDPGSKPTPPGMADELPTETYDLPPEIYTTTF
LPRTIYPQEEMPYDDKPFPSLLSKANDLNAVFEGPACAFPFTYKGKKYYMCTRKNSVLLW
CSLDTEYQGNWKFCTERDEPECVFPFIYRKKSYESCTRVHSFFWRRWCSLTSNYDRDKAW
KYC
Download sequence
Identical sequences P81019
NP_777267.1.59421 NP_777267.1.76553 ENSBTAP00000052231 ENSBTAP00000052231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]