SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052487 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052487
Domain Number 1 Region: 20-173
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-18
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 2 Region: 401-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000001
Family EGF-type module 0.001
Further Details:      
 
Domain Number 3 Region: 243-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 5 Region: 362-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000244
Family EGF-type module 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052487   Gene: ENSBTAG00000002758   Transcript: ENSBTAT00000003575
Sequence length 578
Comment pep:known chromosome:UMD3.1:13:42217371:42221004:-1 gene:ENSBTAG00000002758 transcript:ENSBTAT00000003575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVLLLGVLAPAGLGLPAPPEPQPLGGQCVDLDCFAVFRGPATFLAASRVCERLQGHLM
TVRSSVAEDVISLLLSGDGPRLWIGLQRPPGCDDPEHSGPLRGFQWVTGDNRTSFSRWAR
PHDDGARLCGPLCVAVSAAAGALAPGEPAWEERPCDAEADGFLCEFHFAASCRPLAVDPG
ATAAAGLSITYGTPFGARGADFQALPLGSTAAVAPLGVELECAAQPGETEGRWSREAPGA
WACGVERGGCQHECKGSAGASNCLCPADAALQADGRSCGLPAEHPCHQLCEHFCHLHGLG
NYTCICEAGYQLAADQHRCEDVDDCAQLPSPCPQRCVNTEGGFQCHCDTGYELVDGECVD
PVDPCFDNNCEYQCQPVGRSEHKCICAEGFAPVPGAPHKCQMFCNQTSCPADCDPHYPTI
CRCPEGYIIDEGSTCTDINECDTNICPGQCHNLPGTYECICGPDSALSGQIGIDCDPTQV
NEERGTPEDYGGSGEPPVSPTPGATARPSPAPAGPLHSGVLVGISIASLSLVVALLALLC
HLRKKQGASRGELEYKCGVPAKELMLQQVKTERTPQKL
Download sequence
Identical sequences F1N6M2
NP_001159994.1.59421 NP_001159994.1.76553 ENSBTAP00000052487 ENSBTAP00000052487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]