SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052573 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052573
Domain Number 1 Region: 339-451
Classification Level Classification E-value
Superfamily SRCR-like 1.27e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00043
Further Details:      
 
Domain Number 2 Region: 21-128
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00091
Further Details:      
 
Domain Number 3 Region: 236-342
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00066
Further Details:      
 
Domain Number 4 Region: 129-216
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052573   Gene: ENSBTAG00000022514   Transcript: ENSBTAT00000013933
Sequence length 453
Comment pep:known_by_projection chromosome:UMD3.1:3:12546984:12563851:1 gene:ENSBTAG00000022514 transcript:ENSBTAT00000013933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFFFLIFAFSTGPGLLESPPKVRLVRGPHRCEGRVEVERNGEWGTVCDDGWNLKDVEV
VCRELGCGAAKGTPSGNLYKPLADEKQKIFIQDVNCNGTEDELIECDRVEDVFDCSHSED
AGAICEKSPPKVRLVRGPHRCEGRVEVERNGEWGTVCDNGWNMKDVEVVCRELGCGAAKG
TPSRNLYKPLADEKQKIFIQDVNCNGTEDELIECDRVEDDIFSKKDSELGAPLCGKGTVR
LVDGPGRCKGRLEVKHQKQWGTVCKAGWNLSAAKVVCRQLGCGKATLIKRCCNKDTQGQG
LIWLSNVSCSGQEEDLQHCLSGLEGYNNCTHDEDTWVECEDPFKLRLVNGDTSCSGRLEV
LHKGIWGSVCDDGWAKKEEQVVCQQLGCGKPIFVPAKARKKFVPGNGRIWLDDVHCKGEE
QSLEQCQHRSWGYHDCNHKEDVVVFCLEGQPDI
Download sequence
Identical sequences F1N514
ENSBTAP00000052573 ENSBTAP00000052573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]