SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052704 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052704
Domain Number 1 Region: 147-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-43
Family SPRY domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000052704
Domain Number - Region: 5-92
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00288
Family HBL-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052704   Gene: ENSBTAG00000003743   Transcript: ENSBTAT00000055369
Sequence length 336
Comment pep:known chromosome:UMD3.1:9:57516094:57517306:1 gene:ENSBTAG00000003743 transcript:ENSBTAT00000055369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYQKKLQSCLQRLKGKKQEAEELEIKVREEMSTWKIQIQNEIQNVQGKFTQLRQILDNEE
IKELRKLKDELGVILKELAGSKNDLVQEKLLVSNLISDVERHLQGSTVELLQDVNVIMKR
SETLALKKPKSFPKEQREILHVFNELTDVQRYWVQVTLNSPKCANVVISPDQTQVRYASS
DQGYNAYLNYNYETFGVLGSPVITSGRHYWEVDVSKKSAWILGVCGEKCENTIYQPKNGY
WVIGLKHDSVYNAFESSFSGPVILSLSLSVSPHRVGVFLDYEAHTVLFLNVTNHGFPIYT
FSSCSFPQNIVPYFNPMNCVPLTVGASDTPVLICNI
Download sequence
Identical sequences F1N434
ENSBTAP00000052704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]