SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052785 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052785
Domain Number 1 Region: 440-547
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 668-776
Classification Level Classification E-value
Superfamily SRCR-like 1.2e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 3 Region: 106-211
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 549-656
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0024
Further Details:      
 
Domain Number 5 Region: 211-311
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 6 Region: 314-413
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0071
Further Details:      
 
Domain Number 7 Region: 6-104
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052785   Gene: ENSBTAG00000039256   Transcript: ENSBTAT00000055707
Sequence length 905
Comment pep:novel chromosome:UMD3.1:5:103276708:103332323:-1 gene:ENSBTAG00000039256 transcript:ENSBTAT00000055707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPSTSEFLALRMVSEDQQCAGWLGVFYNGTWGSVYRSPMEDITVSMICRQLCGDSGSLN
ASICLSSLDPSVWKTDTSVWQCPSDPWVYSSCFPKEEAYISCADREKLRLRGGGSKCAGW
VEVWHSGSWGTACNDSWSLAEAEVVCQQLGCGQALEAVRAAAFGPGNGSIWLDEVRCRGR
ESSLWDCAAEPWGQSDCKHEEDAGVRCSGFVHLAGGVGPCSGRVEVHSGEAWTPVSDGNF
TLPTAQVICAELGCGKAVSVLGHVPFRESDRWVWAEEFRCEGEEPELWSCPRVPCPGGTC
HHSGAAQVVCSVYTEVRLMKNGTSQCEGQVEMNISGHWRALCASHWSLANANVVCRQFGC
GVAISTPNGAEGSDQLCHCSGAESFLWKCPVTALGVPDCSRGNTASVICSGNHTQMLPQC
NNSVSEQAGSAASEESAPYCSDSRQLRLVDGGGPCAGRVEILDQGSWGTICDDYWDLDDA
HVVCRQLGCGEALNATGSAHFRAGSGPIWLDDLNCTGKESHVWRCPSRGWGRHDCRHKED
AGVICSALEFLALRMVSEDQQCAGCLEVFYNGTWGSVCCSPMKDITVSMICSQLGCGDSG
SLNTSVGLREGSRPRWVDLIQCRKTDTSLWQCPSGPWKYSSCSPKEEAYISCAGRRPKSC
PTAAPCTEKLRLRGGHSKCSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGQALEAL
RSAAFGPGNGSIWLDEVRCGGRESSLWDCAAEPWGQSDCKHEEDAGMRCSGVTTTLPMTT
AGTRTTSNSLPGIFSLPGILCLILGALLFLVLVILVTQLLRWRAERRALSSYGDALAEAV
YEELDYLLTQKEGLGSPDQRTDVPAENYDDAEEVPVPGTPSPFQGNEEEVPPEKEDGVRS
SQTGE
Download sequence
Identical sequences G3X8C9
ENSBTAP00000052785 ENSBTAP00000052785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]