SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052788 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052788
Domain Number 1 Region: 788-891
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 540-647
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 3 Region: 329-433
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 434-539
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 5 Region: 893-993
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000488
Further Details:      
 
Domain Number 6 Region: 8-116
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 7 Region: 223-328
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 
Domain Number 8 Region: 116-221
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 9 Region: 681-781
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052788   Gene: ENSBTAG00000039755   Transcript: ENSBTAT00000054929
Sequence length 993
Comment pep:novel chromosome:UMD3.1:26:42930023:42982387:1 gene:ENSBTAG00000039755 transcript:ENSBTAT00000054929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFSPAGDWPTLRLVNGPGRCSGRVEVSYQGSWGSVCGKGWGLKEAHVVCRQLGCGWAVS
TPPGAHFSPGFGKILLDNVHCSGEESHLALCAHDTWFTHSCGHEADAGAICSGWAWVAVR
LVGGPGRCSGRVEVLVQDTWGTVCDDFWDLAEAAVVCRQLECGQAVVAPTGAHVGVGSGK
IVLDNMQCVGSKSHLEQCMHGGEAGHNCGHQEDASVICTARAWVAVKLVGGPGRCSGRVE
VLVQDTWGTVCDDLWDLAEAAVVCRQLECGQAVAAPTGAHFGAGSGKIALDNLQCVGSES
HLGQCVHGGEAGHNCGHLEDASVICAGGWAPVRLVGGHGSCAGRVEVFYQGAWGTVCDSL
WDLPEANVVCRQLGCGRAMEAPGKAHFGEGSGKVLLDNMQCRGHEEHLDECSHAGWFAHN
CGHREDAGVVCSGDWPELRLVGGSGRCSGRVEVLHEEAWGTVCDDLWDLNEAEVVCRQLG
CGQAVSALGKAHFGPGSGDIFLDNLQCAGAERHLGQCAHSGWSEHNCGHHEDAGVICSGD
WPELRLVGGSGRCSGRVEVLHEGAWGTVCDDLWDLNEAEVVCRQLGCGRAVSALGKAHFG
PGSGDIFLDNLQCAGAERHLGQCAHSGWSEHNCGHHEDAGVICSASQDHTSSACGRSTIG
CQRPRSSPVYRAVRCLQEDEPELQMVGSSEQCSGRVEILHQGAWGTVCDDLWDLNKAGVM
CWQLGCGRAITAPGKTHFSPGSGDILLDNLQSLGIESHLGQCPSSGWSDPNCGHHEDAGV
IYSEFSESLRLGNGSHRCEGRVEVSYNGTWGTVCDDSWDLTDARVVCQQLGCGEALSAPK
QSYFGGGTGHIILDNVQCVGNEAKVWQCPHSGWFSHNCGHHEDAGVVCSDAMLRLADGSP
PCEGRVELHFNGSWGTVCDDSWDLQDAEVVCRQLSCGGAVSAPGRARFGRGLGPIALDDV
RCVGTEARLWQCLHGGWFSHNCGHHEDAGVVCS
Download sequence
Identical sequences F1N2X6
ENSBTAP00000052788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]