SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052821 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052821
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Ribosomal protein S8 2.62e-44
Family Ribosomal protein S8 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052821   Gene: ENSBTAG00000034656   Transcript: ENSBTAT00000049093
Sequence length 130
Comment pep:novel chromosome:UMD3.1:24:12798435:12798827:-1 gene:ENSBTAG00000034656 transcript:ENSBTAT00000049093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIIRFLTVMMKHGYIGEFEIIDDHRAGK
IVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLSSRQFGFIVLTTSAGIMDHEEARRKH
TGGKILGFFF
Download sequence
Identical sequences E1BLY1
9913.ENSBTAP00000052821 ENSBTAP00000052821 ENSBTAP00000052821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]