SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052860 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052860
Domain Number 1 Region: 400-707
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.74e-55
Family Rhodopsin-like 0.00092
Further Details:      
 
Domain Number 2 Region: 29-253
Classification Level Classification E-value
Superfamily L domain-like 1.65e-30
Family Ngr ectodomain-like 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052860   Gene: ENSBTAG00000017489   Transcript: ENSBTAT00000052615
Sequence length 763
Comment pep:known_by_projection chromosome:UMD3.1:10:93417338:93571380:1 gene:ENSBTAG00000017489 transcript:ENSBTAT00000052615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPTPLLRLALFLVLPSSLGGERCPSPPCECRQEDDFRVTCKDIQSIPSLPPSTQTLKFI
ETHLKTIPSRAFSNLPNISRIYLSIDATLQQLESHSFYNLSKVTHIEIRNTRSLTYIDSG
ALKELPLLKFLGIFNTGLRVFPDLTKIYSTDVFFILEITDNPYMTSIPANAFQGLCNETL
TLKLYNNGFTSIQGHAFNGTKLDAVYLNKNKYLTVIGQDAFAGVYSGPTLLDISYTSVTA
LPSKGLEHLKELIARNTWTLRKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILQSLM
CNESSIRGLRQRKSASALNGPFYQEYEDLGDGSAGYKENSKFQDTHSNSHYYVFFEEQED
EIIGFGQQLKNPQEETLQAFDSHYDYTVCGGSEDMVCTPKSDEFNPCEDIMGYKFLRIVV
WFVSLLALLGNVFVLVILLTSHYKLTVPRFLMCNLAFADFCMGLYLLLIASVDLYTQSEY
YNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWHAITFAMRLDRKIRLWHAYVI
MLGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIILVLLLNIIAFIIVCACY
VKIYITVRNPHYNPGDKDTRIAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKI
LLVLFYPLNSCANPFLYAIFTKAFQRDVFMLLSKFGICKRQAQAYRGQRVSPKNSTGIRV
QKVPPDVRQSLPNVQDDYELLENSHLTPKQQDQTSKEYKQTVL
Download sequence
Identical sequences F1N4F6
ENSBTAP00000052860 ENSBTAP00000052860 9913.ENSBTAP00000052860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]