SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053049 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053049
Domain Number 1 Region: 53-169
Classification Level Classification E-value
Superfamily L domain-like 7.37e-25
Family Ngr ectodomain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053049   Gene: ENSBTAG00000039933   Transcript: ENSBTAT00000052628
Sequence length 253
Comment pep:known_by_projection chromosome:UMD3.1:19:40925114:40926225:1 gene:ENSBTAG00000039933 transcript:ENSBTAT00000052628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGTVYPKGPSVAMFPPASYLLSLLLVIDAGGAVPSPQGVPHGCYAAEEAGERTFRCSQAG
LSAVPTSIPNDTRKLYLDANRLVSVPAGAFQHLPVLEELDLSHNVLAHLSGAAFQGLAGT
LRHLDLSANQLASVPVEAFMGLKIQVNLSANPWRCDCALQEVLRRVRLAPGTGTGIVCGP
GARPDLVGQEFLPLVGEEELCGMGRGGARRSTDVALLVTMGGWLVLVVAYLAHYVWQNRD
ETRRPLKRAPMLP
Download sequence
Identical sequences F1MPC4
ENSBTAP00000053049 ENSBTAP00000053049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]