SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053169 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053169
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000614
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 3 Region: 470-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000711
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 4 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 139-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053169   Gene: ENSBTAG00000000793   Transcript: ENSBTAT00000061289
Sequence length 1193
Comment pep:known_by_projection chromosome:UMD3.1:16:65705535:65771215:1 gene:ENSBTAG00000000793 transcript:ENSBTAT00000061289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLSGCLCLSLLLPAARANSRTPVCDCNGKSRQCIFDQELHRLTGNGFRCLHCSDNT
GGIHCERCKEGFYRHRERDRCLPCNCNSKGSLSPRCDNTGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCTQDRKLLDSKCDCDPAGIVGPCDTGRCVCKPAVTGERCDRCRPGYYHLDGRN
PEGCTQCFCYGHSASCQSSGDYSVHKITSTFHQDVDGWKAVQRNGFPAKLQWSQRHQDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLQITAPL
MPRDKTLPCGITKTYTFRLNEHPSSNWRPKLSYFEYRRLLRNLTALRIRATYGEYSTGYL
DNVTLISARPVSGTPAPWVEQCVCPVGYKGQFCHECASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECEDCPIGFYNDPHDPGSCKPCPCRNGFSCSVMPETEEVV
CNNCPHGITGARCELCADGYFGDPFGEHGPVRPCQPCQCSDNVDPSAPGNCDRLTGRCLK
CLHNTTGAHCDQCKAGYYGDPLAPNPADKCRACNCNPMGSEPVECRSDGSCVCKPGFDGL
NCDHAALTNCPACYNQVKSQMDQFMQQLESLETLLSKAQAGGGAVPDTELEGRMQQAEQA
LQDLLREAQISEGAIRSLNLQLAKARSQENSYQTRLDDLKMTVERLRTLGSQHQDRVQDT
RRLITQMRLSLEESEAALRNTNIPPSEHYTGPNGFKSLAQEATRLADSHVESANNMEQLV
RETEDYSKQALTLARKAAAEGGSSGSLRGSVVQELGGKLEKIKSLAQQLSREATQIDNEA
DTSYQHSLRLLSSATQLQGVNDQSFQVEAKKIRQKADSLSSLVTKRMDEFKRVQSSLGNW
EEETQKLLQDGKNERQKSDQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFDLQV
EDRKAEAEEAMKRLSYISQKVADASDKTRRAETALGGAATDAQRAKTAAGEALKIAGKIE
QEIGSLNVEANVTADGALAMEKGLATLKSEMRKVEGELARKEREFDVDMDTVQMVITEAQ
RVDSRAKNAGVTIQDTLNTLDGILHLIEIDQPGSVDEEGLILLEQKLFRAKTQINSQLRP
LMSELEERVRWQRGHLHSLETSIDGILADVKNLENIRDNLPPGCYNTQALEQH
Download sequence
Identical sequences E1B7Q3
ENSBTAP00000053169 ENSBTAP00000053169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]