SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053183 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053183
Domain Number 1 Region: 140-244
Classification Level Classification E-value
Superfamily TAFH domain-like 2.49e-36
Family TAFH domain-like 0.00000436
Further Details:      
 
Domain Number 2 Region: 420-467
Classification Level Classification E-value
Superfamily Histone-fold 2.18e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053183   Gene: ENSBTAG00000047991   Transcript: ENSBTAT00000060959
Sequence length 633
Comment pep:known_by_projection chromosome:UMD3.1:13:55628005:55655516:1 gene:ENSBTAG00000047991 transcript:ENSBTAT00000060959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPPVQISTVQAPG
TPIIARQVTPTTIIKQVSQAQTTVQPSTALQRSPGVQPQLVLGGTAQTTSLGTATAVQTA
TPQRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDG
KIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPASQATTA
LTAVVLSGSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKQGQPTPLVIQPPPKPGAL
IRPPQVTLTQTPMVALRQPHNRIVLTTPQQIQLNQLQPVPVVKPAVLPGTKALSTVSAQA
AAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETF
LLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDD
RYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQ
QQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGPEGSGPGSAVPGSSGVGTPRQFTR
QRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences F1MMS1
ENSBTAP00000053183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]