SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053199 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053199
Domain Number 1 Region: 1229-1568
Classification Level Classification E-value
Superfamily NHL repeat 2.22e-23
Family NHL repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 1538-1557,1584-1726
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000229
Family All0351-like 0.089
Further Details:      
 
Domain Number 3 Region: 924-995
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000124
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 633-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000708
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053199   Gene: ENSBTAG00000007439   Transcript: ENSBTAT00000061315
Sequence length 2769
Comment pep:known_by_projection chromosome:UMD3.1:29:17048263:17489455:1 gene:ENSBTAG00000007439 transcript:ENSBTAT00000061315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKERKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLTYGSRV
KDLVPQEAEEFCRAGTNFSLRELGLGEVTPPHGTLYRTDIGLPHCGYSLGASSEAELEAD
AALSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHSRLRTPP
PPLSHAHTPNQHHAASISSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEQTHAQDNWL
LNSNIPLETRNLGKQPFLGTLQDNLIEMDILSASRHDGAYNDGHFLFKPGGTSPLFCSTA
PGYPLTSSTVYSPPPRPLPRTTFSRPAFNLKKPSKYCNWKCAALSAIAISATLVILLAYF
VAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTGLEIPDRKGKGAAEGK
PSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYG
RKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQRQSRGAIPPSSHETGFIQYLDSGIWH
LAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVL
CSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSHHGTCIMGTCICNPGYKGENCEEV
DCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTGLCSCDPSWT
GHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPG
WNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGAGCDTSMETACGD
SKDNDGDALVDCMDPDCCLQPLCHVNPLCLGSPDPLDIIQETQAPVSQQNLHSFYDRIKF
LVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPLFGYTISRQDGSF
DLVTNGGVSIILRFERAPFIAQEHTLWLPWDRFFVMETIVMRHEENEIPSCDLSSFARPN
PVVSPSPLTSFASSCAEKGPIVPEIQALQEEIAISGCKMRLSYLSSRTPGYKSVLRISLT
HPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGY
EYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQP
PVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGADGSLYVGDFNYIRRIFPSGNV
TNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDTTSRRVFKIKSTVVVKDLVKNSEV
VAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKSGLIYFVDGTMIRRIDQNGVIST
LLGSNDLSSARPLSCDSVMDISQVRLEWPTDLAVNPMDNSLYVLDNNVVLQISENHQVRI
VAGRPMHCQVPGIDHFLLSKVAVHATLESATALAVSHNGVLYIAETDEKKINRIRQVTTS
GEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNIPSSLAVCADGELYVADLGNIRI
RFIRKNKPFLNTQNMYELSSPIDQELYLFDTSGKHLYTQSLPTGDYLYNFTYTGDGDVTL
ITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELAMMTYHGNSG
LLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDVTITT
NLSASGAFYTLLQDQVRNSYFIGADGSLRLLLANGMEVALQTEPHLLAGTVNPTVGKRNV
TLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHRKFT
LRILYDQTGRPSLWSPSSRLNGVNVTYSPGGHIAGVQRGIMSERMEYDQAGRITSRIFAD
GKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDHLSSVTMPNVARQTLETIRSVGYYRNIYQ
PPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAELLYDTTKVSFTYDETAGM
LKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQAVINE
TPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTTVMTHTKHFDAYGRMKEVQYEIFR
SLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRYSYDLN
GNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKMDEDGFLRQRGSDIFEYNSAGLLIKA
YNRGGGWSVRYRYDGLGRRVSSKSSQSHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYD
LQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQIII
GYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSSNIMPFNLYMFKNNNPISN
SQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYELVHTQMKTQEWDNSKSIL
GVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPETKKFASSGSVFGKGVKFALKDGRVA
TDIISVANEDGRRVAAVLNNAHYLENLHFTIDGVDTHYFVKPGPSEGDLAILGLSGGRRT
LENGVNVTVSQINTMLNGRTRRYTDIQLQYGALCLNTRYGTTLDEEKARVLELARQRAVR
QAWAREQQRLRDGEEGLRAWTEGEKQQVLNTGRVQGYDGFFVISVEQYPELSDSANNIHF
MRQSEMGRR
Download sequence
Identical sequences E1B7E1
ENSBTAP00000053199 ENSBTAP00000053199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]