SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053215 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053215
Domain Number 1 Region: 200-352
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 14-177
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.6e-25
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053215   Gene: ENSBTAG00000044208   Transcript: ENSBTAT00000061049
Sequence length 411
Comment pep:known chromosome:UMD3.1:27:24815381:24828237:-1 gene:ENSBTAG00000044208 transcript:ENSBTAT00000061049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESLASSGVQQTRFPATMVTVDELREMDCSVLKRLMNRDENGGGAGGSGSHGALGLLSGG
KCLLLDCRPFLAHSAGYIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYS
AVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKA
LAAIPPAVPPSTAESLDLSCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGIT
ALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAG
ISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAVEA
ASPSGPLRERGKATPTPTSQFVFSFPVSVGVHPAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences F1MM08
ENSBTAP00000053215 ENSBTAP00000053215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]