SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053271 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053271
Domain Number 1 Region: 97-281,378-423
Classification Level Classification E-value
Superfamily L domain-like 1.28e-24
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053271   Gene: ENSBTAG00000006610   Transcript: ENSBTAT00000061445
Sequence length 798
Comment pep:known_by_projection chromosome:UMD3.1:15:54931232:54989407:-1 gene:ENSBTAG00000006610 transcript:ENSBTAT00000061445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAELYKLDDGKPHLSNCFPAKNLLRTPEEAGRGHWLVARKGGLKKKPKNVAETTAEGQ
EGQKVSFEVEGKKGSRQENQVDTPGHMLDLAFLLKHHCVKDPSDLCSINVSGLKFSKAKE
KDFKHFNSVIYINASENLLPLEAFHTFPVLKELELAFNGIKTVYVKYGDFKSLEFLDLSF
NSLTAEAICDLGILPHLRVLLLTGNGLTSLPPSLAVAEQEASVTSLTTKRYILRFPALET
LMLDDNKLSNPNCFVSLAGLKRLKKLSLDQNRIFRIPYLQQVQLRDGSGDWVGGRGSPRK
QPQSMLQSKSWIYEASDDQPDYTILPMKKDVDRTEVVFSSYPGFSTSETTKVCALPPIFE
ILPVKSLKARNQTLAPPFPELRYLSLAYNKIAKEDAILPVALFPSLCELIFHNNPLVAHT
RGVPPLLKSFLQERLGIHLIRRKIVKAKHHILMPRKDSRKVKTQVPKVPKQPMILPHPSV
MIKSPSKEMLESEAELTMEPPPTKTISVEREMPIEGLGGPPMPHRTFVPLPPICSDSTVH
SEETSPRSDAAGRLSADQLSDEDTKSTESIFLTQVSGLSSSIFQRDDSEIKEKEQRPPST
APREAKRTQKKPPSASFPRKYHGYEELLTAKPDPTFVEPKGIQKNAQALQHMLKHPLVYR
SSKPRLDTLQKHYVPKEKRTRRIPVPPRRKTRAQLLDDILIRMRDTQNITEAPLGAVLRQ
RTEQRLVNQKQFLEAKKLLKEFRARYRRLVRCSLRSVFGTTAPPQARPALSGSQPKLGRF
LEFMDEFYQEPTASDLKG
Download sequence
Identical sequences E1BMB0
ENSBTAP00000053271 ENSBTAP00000008701 XP_005216299.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]