SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053325 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053325
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000422
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 76-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053325   Gene: ENSBTAG00000044033   Transcript: ENSBTAT00000061319
Sequence length 480
Comment pep:known_by_projection chromosome:UMD3.1:7:86158700:86638968:-1 gene:ENSBTAG00000044033 transcript:ENSBTAT00000061319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHSVAAWLLLGLSLSVPQFCRGDICDPNPCENGGICLPGLSDGSFSCKCPDGFTGPNCS
SVVEVASDDEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEAEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWTMYKAKGTNEDMVFHGNVDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences E1BPX2
XP_002689420.2.76553 XP_005903812.1.15283 XP_019820954.1.53367 XP_618255.4.59421 ENSBTAP00000053325 ENSBTAP00000053325 9913.ENSBTAP00000053325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]