SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053345 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053345
Domain Number 1 Region: 879-1154
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000985
Further Details:      
 
Domain Number 2 Region: 1152-1449
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 
Domain Number 3 Region: 23-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-42
Family MAM domain 0.0000000301
Further Details:      
 
Domain Number 4 Region: 383-577
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-28
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 281-414
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000227
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 6 Region: 190-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000562
Family I set domains 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053345   Gene: ENSBTAG00000024015   Transcript: ENSBTAT00000061002
Sequence length 1451
Comment pep:known_by_projection chromosome:UMD3.1:24:40768713:41437121:1 gene:ENSBTAG00000024015 transcript:ENSBTAT00000061002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLGTCLATLTGLLLTAAGDSFSGGCLFDEPYSTCGYSQAVDDEFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSAPGSLNVYVKV
NNGPLGSPIWNISGDPNRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVQDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTDGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWSDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YKVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELVVQTDED
LPGAVLTESIQGSTFEEKIFLQWREPIETYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DSTVTVLLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPANSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYFQAASRANGETKIDCVRVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAQKRKETMSST
RQEMTVMVSSMDKSYAEQGTSCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDETHTMASDTSSLVQPHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTVEGDNSDYINGNYIDG
YHRPNHYIATQGPMQETISDFWRMVWHENTASIVMVTNLVEVGRVKCCKYWPDDTEIYKD
IKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVK
SKSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTE
EQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLR
VEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQ
HPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEE
DIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGG
EGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFC
YEVALEYLNTG
Download sequence
Identical sequences E1BPU9
XP_005224353.1.76553 XP_015324634.1.59421 ENSBTAP00000053345 ENSBTAP00000053345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]