SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053353 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053353
Domain Number 1 Region: 1884-2132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.74e-57
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 958-1314
Classification Level Classification E-value
Superfamily L domain-like 4.08e-49
Family Internalin LRR domain 0.059
Further Details:      
 
Domain Number 3 Region: 171-513
Classification Level Classification E-value
Superfamily ARM repeat 2.59e-25
Family Plakophilin 1 helical region 0.077
Further Details:      
 
Domain Number 4 Region: 1333-1493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-24
Family G proteins 0.0029
Further Details:      
 
Domain Number 5 Region: 402-765
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000173
Family Clathrin adaptor core protein 0.076
Further Details:      
 
Domain Number 6 Region: 2192-2275,2337-2475
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000183
Family WD40-repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053353   Gene: ENSBTAG00000016260   Transcript: ENSBTAT00000061570
Sequence length 2527
Comment pep:known_by_projection chromosome:UMD3.1:5:40703505:40916225:-1 gene:ENSBTAG00000016260 transcript:ENSBTAT00000061570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSCQGCEEEDEESLKKLIVRLNNVQEGKQIETLVQILEDMLVFTYADHASKLFQDKN
VHVPLLIVLDSYMRVASVQQVGWSLLCKLIEICPNTMQSLMGPHDIGHDWEVLGVHQLIL
KTLTVHNASVNLTTVGLKALDLLLTSGKITLLILDEENDIFLLIFDAMRTFSASDEVQKL
GCKVLHVLFERVSEEQLTEFVENKDYMILLSALKNFEDEEEIVLHVLHCLHSLAIPCSNV
EVLMSGNVRCYNIVVEAMKAFPISEKIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAV
QQYSENAVLQIAALSCLALLTETIFLNQDLEEKNENQENDDDEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIYLNVLELMQKHMHSPEVAESGCKMLNHLFEESSTSLDTM
AAVVPKIITVMKSHETSLSVQLEALRAMLHFIVPGIPEEYREDTEYQHKLNMIEKQCFRN
DIHKLVLAALNRFIGNPGIQKCGLKVISSIIHFPDALEVLSLEGAIDSVLHTLQMYPDDQ
EIQCLGLSLIGCLITKKNLCMGTGNLLAKILISTLQRFKDIGEVQIKGFQTVLTMLELSV
SFSKLLVHYSFDSVIFHQLSSSITEQKDQQFLNLCCKCFAKLAIDNELKSVMLEKACDQN
NSIMVECLLLLGADANRAKEATSLICQVCEKASSPKLVELLLNSGSREQDVRKALTISIG
KGNSQIISLLLRRLALDLANNSICLGGFCMGKIDPSWLGPLFPDKTSYLRKETNIGSTLA
RMVLRYQMKSSVEEEAGSGSNGNFSEEMVDKFDEWTFVPESYVDSVFGQSDDLDSEGSEG
SFLVKTKSNSISVGEFYQDPALQRCSPNLQRHSSSLGPIFDHEDLIKRKRKIFSSDDSLR
ASKFQSHMKHSESMSSLPSEREYITSLDLSANELKDVDALSQNSCISGHLEHLEKLELHQ
NALTSFPQQLCETLKCLTHLDLHSNKFTSLPTYLLKMNCIANLDVSRNDIGPSVVLDPAV
KCPTLKQFNLSYNQISSLPANLGDVVEKLEQLILEGNKISEICSPLSLKELKILNLSKNH
ISSLSEDFLETCPKVEILSAKMNFLATMPFLPSSITSLKLSQNRFTCVPEAILHLPHLRS
LDMSSNDIRYLPGPVHWRSLNLRELLFSHNQISILDLSEKACAWSRIEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHVGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKIKKSDLGMQGATVGIDVKDWPIQI
RGKGKKDLILNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVTDEKQRKACISKITKELLNKRGFPAIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREH
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVEGFPK
HPKGIISRRDVEKFLSKKKRFPKNYMAQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDHHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDHLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI
LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKTSLTRTLQHRIVLHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIAEGLKFPNEFDELAIQGKLPDPVKEYG
CAPWPMVEKLIKKCLKENPQERPTSAQVFDILNSAELICLMRRISIPKSFTVECMVATNH
NSKNVRIWLGCGHTDKGQLSFLDLNTERYTSEEVTDSRILCLALVYLPVEKESWIVSGTQ
SGTLLVINTEDGRKRHTLEKMTDSVTCLYCNSFSKQSKQKTFLLVGTADGNLAIFEDKSV
KCKGATPLKILNIGNVSTPLMCLSESVNLTEKNIMWGGCGTKVFSFSDDFTIQKLIETRT
NQRFSYASFCDSNIIAVVVDTALYVAKKNSPFVEVWDKKTEKLCELIDCVHFLKEELVRV
SKELKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRIIRIIHNFCDSVRVMMT
AQLGSLKNVMLVLGYNRKSAEGTQHQKEIQSCLSVWDINLPHEVQNLEKHIEVRKELAEK
MRRTSVE
Download sequence
Identical sequences E1BPU0
XP_010803364.1.76553 ENSBTAP00000053353 ENSBTAP00000053353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]