SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053409 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053409
Domain Number 1 Region: 3989-4356
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.02e-98
Family Regulator of chromosome condensation RCC1 0.0041
Further Details:      
 
Domain Number 2 Region: 367-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.74e-95
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 3 Region: 4484-4833
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.97e-90
Family Hect, E3 ligase catalytic domain 0.0000541
Further Details:      
 
Domain Number 4 Region: 3418-3515,3572-3810
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-34
Family WD40-repeat 0.007
Further Details:      
 
Domain Number 5 Region: 2023-2205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-34
Family SPRY domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053409   Gene: ENSBTAG00000019474   Transcript: ENSBTAT00000061038
Sequence length 4857
Comment pep:known chromosome:UMD3.1:10:46241889:46455782:1 gene:ENSBTAG00000019474 transcript:ENSBTAT00000061038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVNSMEKSKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDTPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPELIDPAGMPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVFVDLALGCSKEPARSLWISMQDYAISKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISENQDSADVDPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGARADDPPPQAQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIEELQKRREEGQLQQPSTSTSEGGGLMTRSESLTAESRLVH
ASPNYRLIKSRSESDLSQPESDEEGYALSGRRNVDLDLASSHRKRGPMHSQLESLSDSWT
RLKHNRDWLCSSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSISLTGSRLSSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHAGAKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQAGVLL
MASFGEGEEDEEGKKIDSSGETEKRDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQSK
MASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVVER
LFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQCC
IVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHR
TTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFED
VDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIRIL
HRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREEKENKEEEKGKH
SRHGLADLSEPQLRTLCLEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKEGST
SAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLTGIH
EDMGKQSTKRHEKKHRHESEEKGDVEQKIESESALDTRTGLTSDDVKGTTSSKSENEIAS
FSLDSAVPGVESQHQITEGKRKNHEHMSKNHDIAQSEIRAVQLSYLYLGAMKSLSALLGC
SKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIKRALG
LADLERAQAMIYKLVVHGLLEDQFGGKIKQEIDQQAEESDQAQQAQTPVTTSPSASSTTS
FMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQTPPIS
SLPTSPSDEVGRRQSLTSPDSQSARPTNRTALSDPSSRLSTSPPPPAIAVPLLEMGFSLR
QIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQSGSTADSRHGAAVAGSGGKS
NDPCYLQSPGDIPSADAAEMEEGFSESADNLDHAENAASGSGPPARGRSAVTRRHKFDLA
ARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEAMFGQ
DLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVNFNQHMKRNHPGCGRS
ANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKSKATSSERYKGQAPDL
IGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLGASV
AMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAAQVLL
ARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSAVASA
SERSRGGHSKANKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNLTTVD
DPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKSEVEKKGPLE
LANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTAPQTLADMGGDLRKCSFIKLE
AHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEESLGSPS
DPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPSTAWSGE
SPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVTCIAWFSEDRPFAVGYFDGK
LLLGTKEPLEKGGIVLIDAHKDTLTSMKWDPTGHILMTCAKEENVKLWGPISGCWRCLHS
LCHPSIVNGIAWCSLPGKGSKLHLLMATGCQSGLVCVWRIPQDTTQTSVTSSEGWWDQES
SCQDGYRKSVGAKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSVLQTV
VIGSGAIQTTVWIPDVGVAACSNRSKDVLVVNCTAEWTAANHVLATCRTALKQQGILGLN
MAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCNPPV
PPHHQHCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPEDELVL
LMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPS
FSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLV
TSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKH
SAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADG
SMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQ
DRLIGLPEGRARNHNRPQQIPVLAGVVIEDVAVGAEHTLALASTGDVYAWGSNSEGQLGL
GHTNHVREPTLVTVLQGKNVRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDTVPPQ
YGALREVSIHTARARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQLRP
LLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNASDL
RLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYNRDRFL
FNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEEVDLLY
VQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKEYVE
RAIEYRLHEMDRQQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEISVEVLKKVVRY
REVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRPYDS
LPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTDY
Download sequence
Identical sequences F1MNS0
ENSBTAP00000053409 ENSBTAP00000053409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]