SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053422 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053422
Domain Number 1 Region: 55-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-34
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053422   Gene: ENSBTAG00000035054   Transcript: ENSBTAT00000061549
Sequence length 926
Comment pep:known_by_projection chromosome:UMD3.1:9:9517340:9608712:-1 gene:ENSBTAG00000035054 transcript:ENSBTAT00000061549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLWKIPVLFFVCSFLGTWASVTVKRRPRFPVNSNSNGENELCPKVRIGQDDLPGFDLI
SQFQIDKAASRRAIQRVVGSTALQVAYKLGNNVDFRIPTRHLYPNGLPEEYSFLTTFRMT
GSTLEKHWSIWQIQDSSGKEQVGVKINGQTKSVSFSYKGLDGSLQTAAFSNLPSLFDSQW
HKIMIGVERSSATLFVDCNRIESLPIKPRGQIDVDGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPRRETCNELPARITAFAAQTIDQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPK
GPPGPPGPPGEPGKPGAPGKPGTPGADGKGLQAGEGQSPPKPRGRDQRKTDWGRACPGRD
IPFNLGPCFICGLPPLTGTLWKFWPVTYHTKNFAGSPPGSPPTSVTHSPEDTCPNTLDQP
GRPGYPERPAQRGRHKTSCEESGVMPRSKHQGEEGDQGGLGEVGAQGPPGAQGLRGITGV
AGEKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEIGPKGDRGPQGSPGIPGLPGPKGD
TGLPGVDGRDGIPGMPGTKGEPGKPGPPGEAGLQGLPGIPGLPGAKGVAGEKGNTGAPGK
PGQLGNSGKPGRQGPPGEVGPRGPRGLSGSRGEVGPVGPPGPPGKLGSLGSPGLPGLPGP
PGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGVRGP
EGSRGLPGEEGPRGPPGPRGVQGEQGATGLPGIQGPPGRAPTDQHIKQVCMRVIQEHFAQ
MAASLKRPDSGASGLPGLPGPPGPPGPPGENGFPGQMGLRGLPGMKGPPGALGVRGPKGD
AGERGDRGPPGRGPKGLPGAPGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPG
PPGFCEPASCTLQAGQRAFNSKGPNQ
Download sequence
Identical sequences F1MND9
ENSBTAP00000053422 ENSBTAP00000053422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]