SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053469 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053469
Domain Number 1 Region: 399-590
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 182-387
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.36e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 594-774
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.35e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 6-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-37
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 800-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000343
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053469   Gene: ENSBTAG00000024021   Transcript: ENSBTAT00000061495
Sequence length 836
Comment pep:known chromosome:UMD3.1:11:32715365:32880569:-1 gene:ENSBTAG00000024021 transcript:ENSBTAT00000061495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDY
TMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKI
HGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPR
HQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGR
SGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIR
DLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGT
GYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSAD
TLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTV
DDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKN
GDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYN
SGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI
DTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDL
ISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCND
Download sequence
Identical sequences F1MMZ4
ENSBTAP00000053469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]