SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053495 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053495
Domain Number 1 Region: 3875-4068
Classification Level Classification E-value
Superfamily Fibronectin type III 2.13e-37
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 4270-4446
Classification Level Classification E-value
Superfamily Fibronectin type III 3.85e-34
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 3 Region: 4531-4737
Classification Level Classification E-value
Superfamily Fibronectin type III 1.7e-33
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 4735-4934
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-32
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 5 Region: 3516-3683
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-32
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1053-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-31
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 1517-1682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-30
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 8 Region: 2330-2534
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-29
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 9 Region: 1708-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-29
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 2143-2330
Classification Level Classification E-value
Superfamily Fibronectin type III 3.36e-29
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 11 Region: 2820-3021
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-29
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 12 Region: 2532-2675
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-28
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 13 Region: 3690-3869
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-28
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 14 Region: 4081-4265
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-27
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 15 Region: 1467-1512,1915-2057
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-27
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 16 Region: 1246-1288,1319-1413
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-26
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 17 Region: 2689-2822
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-22
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 18 Region: 3021-3150
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-18
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 19 Region: 121-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-17
Family Clostridium neurotoxins, the second last domain 0.045
Further Details:      
 
Domain Number 20 Region: 2051-2143
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000117
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 21 Region: 4431-4541
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000162
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 22 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 23 Region: 3448-3512
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000965
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 24 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 25 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 26 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 27 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 28 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 29 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 30 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053495   Gene: ENSBTAG00000006188   Transcript: ENSBTAT00000061112
Sequence length 5204
Comment pep:known_by_projection chromosome:UMD3.1:16:19573856:20502175:-1 gene:ENSBTAG00000006188 transcript:ENSBTAT00000061112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCLALSLGFGLLFPVPETWLFAYFASISWADSQGLFPRLENVAAFKKVSVVPTQATCGI
PAQSTFCQSSATPEGLRVCPQRLCVQDCPYRSSPPTYANLFSAGLRGCIIKDQRDLSPNS
HNHSASFIFGNHQSCFASPPAPRLAASFTLAVWLKLEQGGVMCVIEKTADGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGLEKDNAAFDAR
TLSGSITDFASGTMQIGQSLNGSEQFVGRMQDFRLYQVALTNREIQEVFSRDLPRLHIQS
HCRCPGSHPRVHRLEQRYCIPNDAEDTTKNRVLRLNPEAHPLSFVNDNNVGTSWVSHVFT
NMTQLSQGVTISIDLENGQYQVFYIIIQFSSPQPTAVRIQRKKEDSLDWEDWQYFARNCS
TFRMKNNGDLANSDSVNCLQLPNFPPYSCGNVTFSVLTPGPNQRPGYNNFYNTPSLQEFV
KATQVRLHFHGQYHTTETPVSPRHRYYGVNEITITGRCQCYGHANHCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNNKPFRQSDHVHAFNCKPCECNSHSRSCHYNISVDPFPFEHYRG
GGGVCDDCEHNTAGKNCELCKDYFFRQVGADPSAIDVCRPCDCDKVGTRNSSFLCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQEWDPDGCSPCNCNTSGTVDGDITCHPNSGQCKCKAN
VIGLRCDHCNFGFKFLQSFNDDGCEPCQCNLHGSVNRLCNPLSGQCECKKEAKGLQCDTC
REHFYGLDATGCKACDCDVAGSRPGTVCDAWTGQCVCKPNVGGRRCSECVEGYFYQPQNR
SFLCLPCNCDRTGTVNGSLLCDKSTGQCPCKLGVTGLHCNQCESHRYHLTVGSFQGCQMC
ECDPLGTLPGTICDPLSGQCPCLPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQSCDYCKDLYFGFDSLTGRCQPCNCHLSGALNETCHLVTGQ
CFCKRFVTGSKCDTCVPNASHLDISNPLGCSKTPSQQPPPRGQVQSSSAINLSWSPPDSP
NAHRLTYSLFRDDFEIYTVEDQYPYSIQYFLDTALVPYTSYSYYILTSSVHGSTRSTAVT
YRTKPGTPVGSLNLSYISPVSSDSVTLTWASPSNRSGPIEKYILSCAPLHDVQPCSPYEG
PETTTTIWNLLPFTKYRFAVQACTSGGCLHSTPLTVTTAQAAPRRLGPPKVRKISSTELH
VEWAPPMEPNGIIIRYELYMKRLKSSGETRSAESQVFQSSGWLGPHPLAESANENALEPP
ETTTVITGLEPYTKYKFRVLAVNMAGSVSSAWTTGRTGESAPIFVMPPSVSPLSPHSLNV
SWELPPDSVTRGKVVGYNISMISEQSPQQSYPMVVPQVLYTAKSQELSYIVKGLKPYRIY
NFTISLCNSVGCVTSASEAGQTLASAPAQLRPPLVEGINSTTMHLRWLAPEEQNGPSPVY
QLERREPSLPAPRAMVMKGTRFTGHGYYKFPSSTHPVNTDFTGIKASFRTRVPEGLIVFA
ASPGNQEEYFAIQLKNGRPYFLFDPQGSAVEVTTTNDDGKQYSDGKWHEIIAIRHQGLGQ
ITLDGLFTGSSATTNGGTVIGENTGVFVGGLPQGYTILRKDSDIVQKGFVGCLKDVYFMK
NYNPSATWEHLVWQSSEEQTNVHNDWEGCPTSLQEGAQFLGTGFLELYPYLFHGGMDFEI
SFKFRTDQLNGLLLFIYNKDGPDFLAMELKSGILSFRLNTSLTFTQVDLWPGLSYCDGKW
NKVIIKKNDSIISASMNELMEHVSESRAQALMVNSPVYVGGIPQELHDPYKHLKLEQGFG
GCMKDVKFARGAVINLASVSSGAVRVNLDGCLSTDSAAKCRGDDSILVYRGEKRTAYESH
LQPFTEYLYRVTASHEGGSVHSDWSRGRTTGAAPQSVPSPSGVRSINGYSIEVTWDEPVV
ARGVIEKYILRAYSEDALGPPHTPSASSELVDTNTFTGILTGLLPFKNYAVTLAACTLAG
CTESLHALNISTPQEAPQQVQPPVAKSLPHSLLLSWNPPQKANGIITQYSLYMDGMLIYS
GNGENYTVTDLAAFTPHQFLLSACTHVGCTNSSLVILSTAQLPPEHVDPPILTVLDSRTV
YIQWKQPRKVNGILERYMLYISNHTHDFTVWDVIYNSTELFQDHTLQYLLPGNKYLIKLA
ACTGGGCTVSKASQALTEERTPEGVPAPRVNPDSSHSFNISWTEPEHPNGVITSYGLYLD
GILIHNSSELSCHASGFAPWSLHSFRVQACTARGCALGPLVENRTLEAPPEGTVNVFVKT
EGSRKAHVRWEPPFHPNGRLMYSVLFTGTFYADQAGDNYTLLNGTQIMHSGEETNLWVLI
NGLVPFTNYTVQVNVSNSQGSLMSDPVMISMPPGAPDGVLPPRLSSATPTSLQVVWSTPA
RNNAPGSPRYQLQMRPGHSTHGFLELFSNPSASLNYEVRDLQPYTEYEFRLVASNGFGSA
HSSWIPFITAEDKPGPVDPPIILDKKSRMMLVTWQHPLKCNGLITHYNIYQHGRLSLETS
GNVTNGTVTHLHPHTAYAFQVEACTSKGCSLSADSQTVWTLPDAPEGILSPELFSDTPTS
VIISWQPPTHPNGLLENSTIQRRVQGKEAVTTLVTLPGSHPRRFIDKTSSLSPWTKYEYR
VLMSTAGGGTNSSDWAEVTTRPSRPAGVQPPEVDVLGPDAAKVTWKPPLILNGDILNYEI
RMPDPHITITNVTSSVLSHVVTHLIPFTNYSVTIVACSGGNGYLGGCTESFPTHVTTPPA
LPQDLGPLSVVPLSESYVGISWQPPSRPNGPDLRYELLRCKIQQPLASNPPEDLNMWHNI
YSGTQRFYEDKGLSRFTTYAYKVFVHNSVGFTPSQEATVKTLAGRPERGANVTVTVLNHT
AIDVRWVKPTFQDLQGDVEYYTLFWSSATSNESRKILPDVHSHVIGHLNPNTEYRIFISV
FNGVASINSEVLHATTCDGEPQGMLPPEVVIINSTAVRVIWTAPSNPNGVVTEYSVYVNN
QLYKTGINVPGSIILRELSPFTVYDIQVEVCTKYACVKSNRTQITTVEDTPSDIPTPTIH
GIASRNYQIFWRSPGRPSGIILGYDLLRKTWRPCSKTKKLMKDHPGGLCKAVECQKHELL
CGTRCYSPEAKVCCNGSLYDPRPGHACCEEKYIAFVLNSTGVCCGGRLRERQPNHQCCSG
YYIRILPGEVCCPDEQHNRVSAGLGNSCCGRMPYSTSGKQICCAGRLHDGHGQQCCGGQI
VSKDFECCGGEEEGVVYSRLPGMFCCGLDYVNMSDTICCSASSGESKAHVKKNDPVPVKC
CETELIPKSQECCNGVGYNPLKYVCSDKISTGMMMKETKACRTLCLTSMEATAHCGRCDF
NFTSHVCTVMRGSHSSVRKESMEEICSSAEETVHTGSVNTLSFTDVNLEPYMMYEYRISA
WNRYGRGFSKAVRARTKEDVPEGVSPPRWTKMDHLDDVIVLSWKKPIQSNGPIIAYILLR
NGIECFRGTSLSFSDTEGIQPFMEYSYQLKACTVAGCATSSKVVAATTQGIPQNIPPPRV
TAPSAEALHVSWHVPPKPNGVIKEYQLRQVGKGLIYTDTTDRRQHTVTGLQPYTNYSFTL
RACTSAGCTSSEPFLGHTLQAAPQGVWVTPRHIVVNSTTVELFWSPPEKPNGLVSQYQLS
RNGSLIFLGGSEEHNFTDKNLEPNSRYVYKLEATTGGGSSPSDEYIIQTPILTPEEIQPP
YNITVIGPYSIFVAWTPPGILVPKMPVEYNVLLNAGSATPLISSVGHHQSILLENLAPFT
QYEIRIQACQKGGCGVSSRMFAKTAEAAPMDLNSPILKALGSACIEVKWMPPKKPNGVII
NYFIHRRPTGIEEESLVFVWSEGALEFIDDADTLRPFTLYEYRVRACNSRGSVDSPWSSA
RTLEAPPQDFPAPWAQVTGAHSVLLNWTEPDSPNGIIFQYRVVYQQKTDDPTLNFSAVHA
FTVMGTSYQAHLFGLEPFTTYHIGVVATNQAGEVSSPWTLVQTLESSPSGLSNFTVEQKE
NGRALLLQWSEPARTNGVIKTYNVFSEDVLEYTGLNRQFLFRRLDPFTLYTLTLEACTRA
GCAHSAPQPLWTEEAAPDSQPAPTIQSVGSTSVELSWSEPIKTNGKIIRYEVIRRCFEGK
AWGNQTIQADEKIVFIESNTERNTFIYNDTGLQPWMHCEYKVHTWNSAGHACSSWSGVRT
RQAPPDGLCPPEVAQVSVNPPKVLISWVPPEQPNGIIQSYRLQRNGVLYPFSFDAVTFNY
TDEKLLPFSTYSYGVTACTSRGCSASTTTSITTLEAAPAGVHPPALRTISATQINVSWSP
PSIQNGEITQYLLRLDGKEYLAGQNLTLLVSHLQPYTQYNFSLVACTKGGCTASMPESAW
TMEAPPQNMDPPKLQVTGSESIEITWKLPRIPNGRIRSYELRRDGTIVYTGLETRYHDFT
LTPGVEYGYTVMANNSQGGVLSPLVKDRTSPSAPSGMEPPRLLAKGPQEIFVTWDPPVRT
NGRIVNYTLFIRDLFERETKIIHINTTHNSFGPQSFMVNQLKPFHRYEVRIQACTRLGCV
SSDWTFIETLEVAPQQQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGRVLYYELYRRQIA
TQPEKSKPVLAYNGSSSSFMDVELLPFTEYEYQVWAVNSAGKAPSSWTRCRTGPAPPEGL
KAPKFHAVSATQAVVNISTPQKPNGIVTLYRLFSRSTSGAQTVLAEGLATQQTLHSLQPF
TTYSIGVEACTCFSCCSQGPTAELRTPPAPPAGLSSPQIQMLASRTASFQWSPPLFPNGV
IQSYELQLYKACPPDSATPCTPSQTETKYRGPGQRASLEGLQPYTTYKLRVVAHNEVGST
VTEWISFVTQKELPQYRAPISVDSNLSVVCVNWSNSFLLNGRLKEFVLTDGGQRLYSGLD
TTLYIPRTADKTFFFQVICITEEGSAKTPLIQYDTSTGFGLVLTTPGEKKGSRSKSTEFY
SELWFIVLMAVLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLPKRRSPLNVYPPGETH
VGLADTKIPRSGTPVSIRSNRSLSVLRIPSQSHGSQTYSQGSLHRSVSQLMDIQDKKVLI
DDSLWETIMGHDSGLYVDEEDLMNAIKGFSSVTKEHTTFTDTHL
Download sequence
Identical sequences E1BP05
ENSBTAP00000053495 ENSBTAP00000053495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]