SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053498 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053498
Domain Number 1 Region: 870-1185
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000118
Further Details:      
 
Domain Number 2 Region: 1143-1443
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000959
Further Details:      
 
Domain Number 3 Region: 33-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-39
Family MAM domain 0.0000044
Further Details:      
 
Domain Number 4 Region: 392-589
Classification Level Classification E-value
Superfamily Fibronectin type III 3.9e-25
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 289-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000133
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 195-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000565
Family I set domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053498   Gene: ENSBTAG00000020829   Transcript: ENSBTAT00000061187
Sequence length 1445
Comment pep:known chromosome:UMD3.1:9:66968686:67594209:-1 gene:ENSBTAG00000020829 transcript:ENSBTAT00000061187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAAALPTFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVS
AQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPG
TLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIA
IDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPVA
QTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQLL
GVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEI
RVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRCH
TFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEET
IIQTDEDVPGPVPVNSLQGTSFENKIFLNWKEPLDPNGIITQYEVSYSSIRSFDPAVPVA
GPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEG
IDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKRETGAMECYQVPVTYQNA
MSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKET
KTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILVVKKSKLA
KKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAES
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSA
SWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDIWLYRDGYQRPSH
YIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCV
EMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHATGLLSFIRRVKFSNPPS
AGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFI
HDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSI
ACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNT
VKDFWRLVYDYGCTSIVMLNEVDLSQGCPQYWPEEGTLRYGPIQVECMSCSMDCDVINRI
FRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTII
HCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALE
YLESS
Download sequence
Identical sequences F1MME1
ENSBTAP00000053498 NP_001178466.1.59421 NP_001178466.1.76553 ENSBTAP00000053498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]